KEGG   Chitinophaga pinensis: Cpin_0728Help
Entry
Cpin_0728         CDS       T00959                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00564  Glycerophospholipid metabolism
cpi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Cpin_0728
Enzymes [BR:cpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Cpin_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like Pyr_redox_2 Pyr_redox_3 NAD_binding_8 Lycopene_cycl Thi4 FAD_binding_3 Cecropin
Motif
Other DBs
NCBI-ProteinID: ACU58226
UniProt: C7PIN7
LinkDB All DBs
Position
complement(873707..875299)
Genome map
AA seq 530 aa AA seqDB search
MNRLTFKQQIGDTTSVVWDIIVIGGGATGLGVAMDAAQRGFRTLLLEQSDFAKGTSSRST
KLVHGGVRYLAQGDVGLVKEALHERGLLLANAPHLAHDQEFIIPYYKWWQGPFYGIGLKL
YDFLSGRLSLGPSKVIGREAVIKALPAIRRDKLKGGIIYHDGQFDDARLAINIAQTAAEK
GAVLLNYFKVKGLQKDRSGRINGVSATDLETGENYQLQAKAVINATGVFADEVLQMDEPG
ARPTIRPSQGVHLVLDASFLNSTSALMIPKTADGRVLFALPWHGKVLVGTTDTPLNEHSL
EPQALETEISFILQTAAGYLLKAPTRADVLSVYAGLRPLAAPQKETDSTKEISRSHKIIV
APSGLITITGGKWTTFRKMAEDTVDMAISTVGLAAVPCGTETLHIHGYKTGHTATAPLDV
YGSDAAQLETLINTRSDLKELLNPRLPYMKAQVIWAVQQEMARTVDDVLSRRLRALLLDA
HAAIEMAPGVAAIMATELGKDKAWEQEQVTAFTAIAAHYLLPLSASGNHH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggttaacctttaaacaacagattggtgatacgacttcagtcgtttgggatatt
attgtaatcggcggtggtgcaaccggactcggggttgccatggatgccgcacaaagaggc
tttcgcaccctgttactggaacaatcagatttcgcaaaaggcacttccagccgtagtacc
aaactggtacatggcggcgttcgttatctcgctcagggagatgtcggccttgtaaaagag
gcgcttcatgaaagaggactgttgctggcgaatgcgccacatcttgcacatgaccaggaa
tttatcattccatattataaatggtggcagggccctttctacggaatcggccttaaactt
tacgacttcctgtcaggacggcttagcctgggaccctctaaggtcataggtcgggaagct
gtcatcaaggcgttaccggctatacgcagagacaaactcaagggaggtattatttatcac
gacggacagtttgatgatgcccgtctggcaataaacattgcacaaacagccgctgaaaaa
ggcgctgtgctgctcaattattttaaagtcaaaggtttacagaaagatagatccggcagg
atcaacggggtgagcgcaacagacctggaaaccggggaaaattatcaattgcaggcaaaa
gcggtgatcaatgcgaccggcgtatttgctgatgaagtattgcaaatggacgaaccgggc
gccagaccgaccatccgtccgagtcagggtgtacacctcgtactggatgcatcatttctc
aacagcaccagcgcactgatgattcctaaaactgctgatgggcgtgtgttatttgcattg
ccctggcatgggaaggtactggtaggcactaccgatacaccattgaatgaacatagtctg
gaaccacaggcattggagacagagatcagctttatccttcagacggcagccggctacctg
ttaaaggcccctacccgtgcagatgtgctgagcgtgtatgcggggctgcgaccactggct
gctccgcagaaagaaacggatagtaccaaggagatatcccgtagtcataaaatcatcgtc
gccccctccggattgatcaccatcaccggtgggaaatggaccaccttccgaaaaatggcg
gaagacacggtggatatggccatcagtactgtcggtctggcggctgttccctgtggaaca
gaaaccttgcacatacatggatacaagaccggacataccgcaacagcgccattggacgta
tacggcagcgatgctgcacaactggaaacgctgatcaatacaagatcggatctgaaggag
ttgttgaatcccagactgccttatatgaaagcgcaggtaatctgggcggtgcagcaggaa
atggcccgtacggtggatgatgtgttgtccaggcgattacgcgctttactactcgatgca
catgccgccattgagatggcgcctggtgtagccgcgattatggcaactgaactgggaaaa
gataaggcatgggaacaggagcaggtgaccgccttcacagcgattgccgctcattacctg
ttaccgctatctgcatccggcaatcatcattag

DBGET integrated database retrieval system