KEGG   Chitinophaga pinensis: Cpin_1061Help
Entry
Cpin_1061         CDS       T00959                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cpi  Chitinophaga pinensis
Brite
Enzymes [BR:cpi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cpin_1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACU58559
UniProt: C7PML5
LinkDB All DBs
Position
complement(1268939..1269544)
Genome map
AA seq 201 aa AA seqDB search
MAFTLPSLPYAHDALEPHIDKLTMEIHHGKHHQAYVDNLNKAIAGTENENKSLEELVASA
GKISPAVRNNGGGHWNHSFFWKVIGPNAGGEPTGALADAIKSTFGSFEEFKEKFANAGAT
RFGSGWAWLIVKDGKLEITSTPNQDNPLMDVAEVKGTPVLGIDVWEHAYYLKYQNRRPEY
LKAFWSVVNWSEVAKNYEAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcatttacacttccgagcttaccgtacgcacacgacgcactggaaccacatattgat
aaactgacaatggaaattcaccacggtaagcaccatcaggcatatgtagacaacctgaac
aaagcgattgccggtactgaaaatgaaaataaatccctggaagagctggtagcaagcgct
ggtaaaatcagccctgctgtaagaaacaacggtggtggtcactggaaccacagcttcttc
tggaaagtaatcggccctaatgcaggtggtgaacctacaggcgcgctggcagatgctatt
aagagcactttcggttcttttgaagaattcaaagagaaatttgctaacgccggtgctacc
cgttttggttccggttgggcatggttgatcgtaaaagacggtaaactggaaatcacttcc
acgccaaaccaggacaatccactgatggatgttgctgaagtaaaaggtacgccagtattg
ggtatcgacgtttgggaacacgcttactacctgaaatatcagaaccgtcgtccggaatac
ctgaaagctttctggagcgtggttaactggagcgaagtagctaagaactacgaagctgct
aaataa

DBGET integrated database retrieval system