KEGG   Chitinophaga pinensis: Cpin_4484Help
Entry
Cpin_4484         CDS       T00959                                 

Definition
(GenBank) nicotinate-nucleotide/dimethylbenzimidazolephosp horibosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00860  Porphyrin and chlorophyll metabolism
cpi01100  Metabolic pathways
Module
cpi_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:cpi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpin_4484
Enzymes [BR:cpi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     Cpin_4484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT Ifi-6-16
Motif
Other DBs
NCBI-ProteinID: ACU61926
UniProt: C7PJ58
LinkDB All DBs
Position
5575174..5576214
Genome map
AA seq 346 aa AA seqDB search
MTTFHIAPLNNDITAALQHKIDSKTKPIGSLGQLEKLALQIGRIQQTQTPALNKPTIVVF
AGDHGVAHEGVSPFPQEVTYQMVFNFLQGGAAINVFTKQNGIAIKVVDAGVNFDFNQHPG
LVHAKVALGTKSFLHEAAMTPAQCETAIERGAAVVKELHEQGCNVIGFGEMGIANTSAAA
VIMSLLCDIPLEQCIGRGTGLDDEGLIRKKVILAESMIRHNKIEKTPLNVLSTFGGFEIA
MMCGAMLQAAAAGMLILVDGFITTSALLVAAKINEQILDYCLFTHQSNEQGHSLMLAHLK
AVPLLSLGMRLGEGTGAAVAYPVIQAAVSFLNEMASFESAGVSNKA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgactacattccatattgcccccctcaacaatgatattacggcggcactgcaacacaag
atagacagcaaaacaaaaccaattggctcattaggacagctggaaaaactggctttacag
atcggccggatacaacagacacagacccctgcgctgaataaacccaccatcgttgttttt
gccggcgatcacggtgttgcgcatgaaggcgtgagtccttttccacaggaagtgacctat
cagatggtctttaatttcctgcagggcggcgctgccatcaacgtatttacaaagcagaac
ggtattgcaatcaaagtcgtagatgcgggtgtcaactttgatttcaaccaacatcccggc
ttggtacatgctaaggtggctctgggtaccaaaagcttcctgcatgaagcagccatgacg
cctgcgcaatgtgagacagccattgaaagaggtgccgcggttgtgaaagaattacatgaa
cagggctgtaatgtgatcggattcggggaaatgggcatcgccaatacctccgcagcagca
gtaattatgagtctgctctgtgatattccattggaacaatgtattggcagaggtaccgga
ctggatgacgaagggctgatcaggaagaaagtgatcctggcagaatctatgatccgtcat
aacaaaattgaaaaaacgcccctgaacgtactcagtactttcggtggatttgaaatagcc
atgatgtgtggcgccatgttacaggcggcggcagctggtatgctgatactggtagatggt
tttatcaccacatctgcattactggtcgctgcgaagataaatgagcaaatattggactac
tgcctgttcacccaccagtcgaacgagcagggtcatagtctgatgctggcccacctgaaa
gctgtacctttattaagcctgggtatgcgcctgggagaaggtaccggcgctgctgttgcc
taccctgttatacaggctgctgtaagcttcctgaatgaaatggccagctttgaatcggcc
ggtgtgtccaacaaagcataa

DBGET integrated database retrieval system