KEGG   Chitinophaga pinensis: Cpin_5642Help
Entry
Cpin_5642         CDS       T00959                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00500  Starch and sucrose metabolism
cpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cpin_5642
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Cpin_5642
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Cpin_5642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase LBP_C DUF3459
Motif
Other DBs
NCBI-ProteinID: ACU63066
UniProt: C7PBK2
LinkDB All DBs
Position
complement(7193894..7195516)
Genome map
AA seq 540 aa AA seqDB search
MMDDLWYKNSVIYSLDLETFMDGNNDGTGDFAGLCDRLDYLHAMGVDTVWLAPFQPTPNK
DNGYDIQDYYGVDPRHGSSGDFVDFMHRADKLGIKVIIDLVVNHTSDKHPWFVMARSSKD
NPKRDWYVWSDKKPSDWDEGMVFPGVQKSTWTLDKESRTYYFHRFHEFEPDLNTDNPAVR
EEITRIMGYWLQLGVAGFRVDAVPFILESPAPGGKKPKMNFDYLKEMRRFLQWRKGDAVL
LGEANVLPKDSMKYFGENSDGIHLMFNFFVNQYLFYALATCKTTPLIKALEQTRLTSSTP
QWAHFLRNHDELDLGRLSEKERNEVFQRFAPEEDMQLYFRGIRRRLGPMLGSRQQNELAY
SVMFSLPGTPVLRYGDEIGMGDNLALDDRNSVRTPMQWSAEYQAGFSKADKLLHPVIDDG
YYSYVHINVEAQRRDAGSMLNWMTSMIRLRRECPEIGNGEWQIIETGYDHILGMYYKWKN
RRLFIWHNFSEKPQELVFMAKEAGTRRLVDLMDNIESIEDEKGRHTITLEAYGYRWFRAG
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgatctctggtacaaaaactcagttatttatagccttgatcttgaaactttc
atggatgggaataatgacggcacgggcgattttgccggtctttgtgatcgtctggactat
ttacacgctatgggagtcgatactgtatggctggcgccctttcagcctactccgaataaa
gataatggttatgacattcaggattattacggtgtagatccccggcatggttccagtggc
gattttgtggattttatgcacagagctgacaagttaggcatcaaagtgatcattgacctg
gttgtcaatcatacttcagataaacacccctggtttgtgatggcccgatcatcaaaggat
aatcctaaacgtgactggtatgtatggtcagataagaagccatctgactgggacgaagga
atggttttccctggtgttcagaagtctacatggacactggataaggagagccgtacttat
tattttcatcggtttcatgagtttgaaccggaccttaatacagataatcctgctgtaagg
gaggagatcacccgtattatgggatactggttacagcttggagtagctggtttccgtgtt
gacgctgttccatttatcctggaatcgccggcgccaggcgggaagaagcctaaaatgaac
tttgattatctgaaagaaatgcgtcgttttcttcaatggagaaaaggggatgccgtactg
ttgggagaggcgaatgtgcttcctaaagacagtatgaaatactttggtgaaaacagtgat
ggtatacacctgatgttcaacttttttgtcaatcagtacctgttttacgcattggccacc
tgtaaaacgacgccgctgatcaaggcgttggagcagacaaggttgacatcatctacacca
cagtgggcacattttctgcgtaaccatgacgaactggacctggggagactgtctgaaaag
gaaaggaatgaagttttccagcgctttgcacctgaagaggatatgcaattatatttcaga
ggtatccgccgtagactgggtcctatgttgggtagcaggcagcagaacgaactggcttac
agtgtcatgttttccttacccggcacaccggtactccgctatggagatgaaataggaatg
ggtgataatctggcattggatgaccggaacagcgtcagaacaccgatgcaatggtcggcg
gagtaccaggcgggtttttcaaaggcagataaattactgcatccggtgattgacgacggt
tattattcatacgtgcatattaatgtggaagcgcagcgcagagacgcaggctctatgttg
aactggatgacgtcaatgataagattaaggagggagtgtccggagattgggaacggagaa
tggcagatcatagaaacgggttatgaccatatattagggatgtattataaatggaaaaac
cgccgcttgtttatctggcataatttcagcgaaaagccacaggaactggtgtttatggca
aaggaggcaggtacccgcagattggttgatctgatggacaatattgaaagtatagaagat
gaaaaaggccggcataccattaccctggaagcttatggctatcgttggttcagggctggc
tga

DBGET integrated database retrieval system