KEGG   Chitinophaga pinensis: Cpin_5767Help
Entry
Cpin_5767         CDS       T00959                                 

Definition
(GenBank) putative alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00500  Starch and sucrose metabolism
cpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cpin_5767
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Cpin_5767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: ACU63188
UniProt: C7PCX4
LinkDB All DBs
Position
complement(7339917..7342052)
Genome map
AA seq 711 aa AA seqDB search
MRKTFIFICCLFLWKMAAAQELLSPDKNLQLQFSITDNGKPTYQLTYKGKAVIKPSHLGL
ELKADASFIDSFEVAGSKASTYDETWEPVWGEVKEIRNQYNELEVNLHQLSTDRTLIVRF
RLFNDGLGFRYEFPQQKHLAYFVIKEERTEFALAGDHKAFWLPGDYDTQEYSTVTSNLSE
VRGKMKDAITPNASQAPFSPTGVQTPLMMKSKDGLYINIHEAALIEYSALSLELDDKNFV
LKSVLTPDAIGDKGYLQAPCKSPWRTVIVSDKAGDILTSKLVYNLNEPPKYADAASWIKP
VKYVGVWWEMITGKSTWAYTDIENVQLGVTDFSKTKPNGKHGANTAHVKEYIDFAAENGF
DAVLVEGWNQGWEDWFGKTKDYVFDFITPYPDFDVQELHRYAASKGIKIIMHHETSSSVR
NYERFMDTAYQFMVNNGYNAVKSGYVGNIIPRGEHHYGQWLVNHYLYAITKAAEYHIMVD
AHESVHMTGLSRTYPNLIGQESARGTEYEAFGGNNPDHTTILPFTRLIGGPMDYTPGIFE
MNVSAYNPDNSSKVNSTLARQLALYVTMYSPLQMAADFPETYRKHMDAFQFIKDVAIDWE
DTKVLEAEPGDYITIARKAKGKNNWFIGSTCDENGRVSKINFDYLDAGWKYIATIYSDAK
DAHYAKNPKAYTIKKMVVTNKTVLSLPCAPGGGYAISVMEADDDAIKALKK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaacgtttattttcatctgttgccttttcctttggaaaatggcagctgcacag
gaactgctttctccggataaaaatctgcagttacagttctctataacggacaacggaaaa
cccacctatcagttgacctataaaggaaaagccgtgatcaagcccagtcacctcggactg
gaactgaaagcagatgcttcctttatcgatagcttcgaagtagccggcagtaaagcttcc
acatatgatgaaacctgggaaccggtatggggtgaggtgaaggagatccgtaaccagtat
aatgaactggaagtgaacctgcatcagctgtctaccgacaggacgcttatcgtacgtttc
cgtttgttcaacgacggacttggtttccgttatgagtttccgcagcagaagcacctggct
tattttgtgattaaggaagagagaacggagtttgcgctggcaggagatcacaaggctttc
tggttacctggcgactatgatacacaggaatatagtacggtgacttccaatctctcggaa
gtgagagggaaaatgaaagatgctatcacgcctaatgcatcacaggctcctttttcacca
accggggtgcaaacaccgttgatgatgaaaagtaaggatggattgtatatcaatattcac
gaagcagcattgattgaatactccgcgctgtctctggaactggatgataagaacttcgta
ttgaaatctgttctgacgcccgatgcgataggcgacaaaggttatctgcaggcgccctgt
aaatcgccgtggagaacggtcattgtgagtgataaagcaggtgatatcctgacttccaaa
ctggtatacaatctgaacgaacctccgaaatatgccgatgccgccagttggatcaaaccg
gtaaagtatgtgggcgtatggtgggagatgattaccggtaaaagtacctgggcttatacg
gatattgaaaatgtacagctgggtgtgactgatttctccaaaaccaaacctaatggtaaa
catggggctaatacagcacatgtgaaagaatatatcgacttcgctgcggagaatggattt
gatgcggtactggtagaaggatggaaccagggatgggaagactggtttggtaaaacgaag
gattacgtgtttgattttatcaccccataccctgattttgatgtacaggaattacatcgg
tatgcggcgtcaaagggtatcaagatcattatgcaccatgaaacctcgtcttctgtacgc
aactatgagcgcttcatggatactgcctatcaatttatggtgaataatggttataatgcc
gttaaaagcggttacgtaggcaatattattccgaggggagaacatcactacggacaatgg
ctggtgaatcactacctgtatgcaatcaccaaagctgcggaatatcatatcatggtagat
gcacatgaatctgtacacatgaccggcttatcccgtacttatcctaacctgatcggacaa
gaatctgcacgtggtacggaatatgaagcatttggtggtaataatcctgatcatactact
atcctgccgtttacaaggctgattggtggtccgatggattatacgcctggtattttcgaa
atgaatgtcagtgcatataatcctgataacagctctaaagtaaacagtacgcttgcccgt
cagctggcgctgtatgtaacaatgtacagtccgttacagatggcggcagatttcccggaa
acctatcgcaaacatatggatgcattccagtttattaaagacgtagcgattgactgggag
gatacaaaagtgctggaagcagaaccgggagattatattacgattgcccggaaagcaaaa
gggaagaacaactggtttataggtagtacctgtgatgagaatggacgtgtctcaaaaatc
aactttgattatctcgatgccggctggaagtatatagcgactatttacagtgatgcaaag
gatgcgcattatgcgaagaatccgaaagcatatactatcaaaaaaatggtagtgaccaat
aaaacggtgttgtcgttgccgtgtgcacctggaggcggttatgctataagtgtgatggag
gcggatgatgatgcgataaaggcactgaagaagtaa

DBGET integrated database retrieval system