KEGG   Chrysemys picta (western painted turtle): 101930831Help
Entry
101930831         CDS       T04662                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00020  Citrate cycle (TCA cycle)
cpic00190  Oxidative phosphorylation
cpic01100  Metabolic pathways
cpic01200  Carbon metabolism
Module
cpic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cpic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cpic_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101930831 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101930831 (SDHA)
Enzymes [BR:cpic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101930831 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 101930831
NCBI-ProteinID: XP_005296564
LinkDB All DBs
Position
Un
AA seq 666 aa AA seqDB search
MAASAGAASRGLAKRLFRPPAGAWPAACQALARNFHFTVYGKKNASAKVSDSISTQYPVV
DHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDN
WRWHFYDTVKGSDWLGDQDAIHYMTEEAPAAVVELENYGMPFSRTEEGKIYQRAFGGQSL
QFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALC
IEDGSIHRLRAKNTVIATGGYGRTFFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPT
GIYGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCG
PEKDHVYLQLHHLPPQQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYK
GQVITHVNGKDQVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALSIAELCKPG
EAVPSIKPNAGEESVANLDKLRFANGNIRTSELRLNMQKTMQNHAAVFRTGSVLQEGCEK
LSHIYHDLDDLKTFDRGIVWNTDLVETLELQNLMLCAMQTIYGAEARKESRGAHAREDYK
VRVDEYDFSKPIQGQQKRPFEEHWRKHTLSFVDVKTGKVTLRYRPVIDKTLNEEDCATVP
PAIRSY
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcagctggcgcggcgtcgcgggggttagcgaagcggctgttccgacccccg
gcgggagcgtggccagcagcttgccaagctcttgcacgtaactttcactttactgtctat
ggaaagaagaatgcatctgctaaagtttctgattcgatttctacacaatatccagtagtg
gaccatgaatttgatgctgtcgttgtgggtgctggtggggcaggtttgcgggctgcattt
ggtttgtcggaggctggatttaatacagcatgtgttacaaagctgttccctaccagatcc
catactgttgctgcacagggagggatcaatgctgccttgggaaacatggaagaagataac
tggagatggcacttttatgacaccgtgaaaggatctgattggctgggagaccaggatgcc
attcattacatgactgaggaggcacctgctgcagttgtagagctggaaaattatggaatg
ccatttagcagaacagaagaagggaagatctatcagcgtgcttttggtggacagagcctt
cagtttgggaaagggggacaggctcatcgatgctgttgtgtcgcggacaggacaggacac
tcactgttgcataccctgtatggcaggtcgctaagatatgataccagctattttgttgag
tattttgccttggacctcctgatggaaaatggagaatgtcgtggagttattgcactttgt
atagaagatggctcaatacatcgtttaagagcaaagaacactgttattgccactggtggg
tatggtcgcaccttcttcagttgcacatctgctcataccagcacaggtgatggcacagct
atggtcacacgagctggccttccttgccaggacttagagtttgtacagttccaccctaca
ggtatctatggtgctggctgtcttattacagaaggttgtcgtggtgaaggaggtattctt
attaacagtgaaggtgaaagatttatggagagatatgcacctgttgctaaggatctggct
tccagagatgtagtgtctcgttctatgaccattgaaatccgtgaaggaaggggctgtggc
cctgaaaaagaccacgtatatttgcaattgcaccatttaccaccacagcagctagcaatg
cgcctccctggaatttcagaaacagctatgatatttgctggtgtggatgtcacaaaagag
cctattcctgttcttcctactgtgcattacaatatgggaggtattcctactaactacaaa
gggcaggtaattacacatgtgaatggcaaagatcaagtagtacctggcttgtatgcttgt
ggtgaagcagcctctgcatccgttcatggtgctaatagacttggagcaaactctcttttg
gacttggtggtctttggtcgtgcttgtgcccttagtattgcagaattgtgcaagcctgga
gaagcagttccctcaattaaaccaaatgccggagaagaatctgttgcaaatcttgacaaa
ctacgatttgccaatggaaacattagaacatcagaactgaggcttaatatgcaaaagaca
atgcaaaatcatgccgcggtgttccgaacaggctcagtactacaggaaggctgtgagaaa
ctcagccacatttatcatgatttggatgacctgaagacatttgatagaggtattgtgtgg
aatactgacttagtggagaccttggaactgcaaaatttgatgctgtgtgctatgcaaact
atttatggtgctgaggctcggaaagaatctcgtggagctcatgccagagaagactacaag
gtaagagtagatgaatatgatttttccaagccaatccaagggcaacagaaaagaccattt
gaagagcattggagaaaacacaccctttcttttgtggatgtcaagactgggaaggttact
ttgagatacagacctgtaattgacaaaactttaaatgaagaagactgtgcaacagttcca
cctgctattcgttcctactaa

DBGET integrated database retrieval system