KEGG   Chrysemys picta (western painted turtle): 101930851
Entry
101930851         CDS       T04662                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04010  MAPK signaling pathway
cpic04060  Cytokine-cytokine receptor interaction
cpic04068  FoxO signaling pathway
cpic04144  Endocytosis
cpic04218  Cellular senescence
cpic04350  TGF-beta signaling pathway
cpic04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101930851
   04350 TGF-beta signaling pathway
    101930851
   04068 FoxO signaling pathway
    101930851
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101930851
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101930851
  09143 Cell growth and death
   04218 Cellular senescence
    101930851
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101930851
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101930851
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101930851
Protein kinases [BR:cpic01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101930851
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal TNFR_16_TM
Other DBs
NCBI-GeneID: 101930851
NCBI-ProteinID: XP_005279888
LinkDB
Position
Un
AA seq 567 aa
MGYWKRLGLISLLLLSFSCSAGARRNLKTNLCKWCDSTSPVCEEKVCYSNCNLNSYCESP
YEICVAIWKQDNDSIKISTLCHNPQLPVENVMVPNYNTSRCIMTHQSSEEGIFYICGCVD
EQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQKQKKRAK
DWGQKHPQHQALPEPGKAAEDDEKLSVMTDDNHSSMIFTCANSINHNTELLPIDLDEIVG
KGQFAEVWRAKLNHTTSGQYETVAVKIFPCEEYSSWKNESQIFTEASLKHESVLQFLTAE
DRGAGPRKEYWLITAYHRRGNLKDYLSRHILSWIDLQKMAGSLVNGVAHLHSDYTACGRP
KIPIAHRDIKSTNILVKSKWECVICDFGIALKLDPSLTADDFANSGQVGTARYMAPEVLE
SRVNLEDLESFKQMDVYSMALVLWEMASRCEVVGEVKSYELPFGSKVQEQPCVDTMRDIV
LHGRGRPEIPCNWLVHQGMHFLCDTITECWDHDPEARLTAHCVAERFNLMAQMDCDDILN
NNTDNEGSKTARLSGEHQASDGNRNTQ
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggttactggaagaggctgggtctgatttccctactgctgctgtccttctcatgttct
gccggggcacgaagaaatctgaagaccaacttgtgtaaatggtgcgactccacctcccca
gtgtgtgaggaaaaggtgtgctacagcaactgtaatttgaactcctattgtgagagtcca
tatgaaatctgtgtggccatatggaagcaagacaatgacagcattaagatcagcactctg
tgccacaacccacagctcccagtagaaaatgtaatggttccaaattacaacacctcacgg
tgcatcatgacccatcagtctagtgaggaaggaatattttacatctgtggttgtgtggat
gaacaggaatgcaacgataaactgatatttgaaaaccacaccaatggatactccatgctg
cagagcaaagaggtcattcctgtagcagcaataagcctgctcccccctctgctcgtggct
gtcatgatcacggtgatattttacctctgccgcactcagaagcagaaaaagagagccaag
gactggggccagaagcacccacagcaccaggctttgcccgagccaggaaaagctgctgag
gacgatgagaaattatctgtgatgacagacgacaatcactccagcatgatcttcacctgc
gccaacagcatcaaccataacaccgagctgttgccaattgacctggatgagatagtgggg
aaaggccagtttgccgaggtctggagggccaagctgaaccacaccacttcagggcaatac
gagacagtagctgttaagattttcccgtgcgaggaatattcctcatggaaaaatgaaagc
cagatctttacagaggccagcctcaagcatgagagtgtccttcaattccttacagcagag
gacaggggggctgggcctcggaaggaatactggctcatcactgcctaccatagaaggggc
aacctgaaggactatctgtcccgacacattctgagctggatagacttacaaaaaatggcc
ggctccctggtgaacggcgtggcccacctgcacagtgactacactgcctgtggcaggcca
aagatcccaatcgctcaccgggatatcaaaagcaccaacatcctggtgaagagcaagtgg
gagtgcgtgatttgtgattttggcattgctctaaagctagacccttccttaacagcggat
gactttgctaacagcgggcaggttggcactgccaggtacatggctcctgaggttctagag
tctagagtgaatctggaagacctggagtctttcaaacaaatggacgtctactccatggcc
ttggttttatgggaaatggcctctaggtgtgaggttgtaggagaggtaaaaagttatgag
ctaccttttgggtcgaaagtccaggagcaaccctgtgtggataccatgagagacattgtg
ctgcacggcagagggcgcccagagataccctgcaactggctagtgcatcagggaatgcac
tttctgtgcgacaccatcacagagtgttgggaccatgaccccgaggctcgccttacagcc
cattgtgtggcagagcggttcaatctgatggcacaaatggactgtgatgacatcctcaac
aacaatacagacaatgaaggcagcaaaacagcccgtctaagtggggaacatcaagccagt
gacgggaacagaaatacccagtga

DBGET integrated database retrieval system