KEGG   Chrysemys picta (western painted turtle): 101931154Help
Entry
101931154         CDS       T04662                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00010  Glycolysis / Gluconeogenesis
cpic00051  Fructose and mannose metabolism
cpic00052  Galactose metabolism
cpic00500  Starch and sucrose metabolism
cpic00520  Amino sugar and nucleotide sugar metabolism
cpic00524  Neomycin, kanamycin and gentamicin biosynthesis
cpic01100  Metabolic pathways
cpic01200  Carbon metabolism
cpic04910  Insulin signaling pathway
Module
cpic_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cpic_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101931154 (HK1)
   00051 Fructose and mannose metabolism
    101931154 (HK1)
   00052 Galactose metabolism
    101931154 (HK1)
   00500 Starch and sucrose metabolism
    101931154 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    101931154 (HK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101931154 (HK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101931154 (HK1)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101931154 (HK1)
Membrane trafficking [BR:cpic04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101931154 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 101931154
NCBI-ProteinID: XP_005281953
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MIAAQLLAYFFTELKDDQLKKIDKYLYSMRLSDETLLDIMSRFKREMHNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMETEIYDTPEDIMH
GTGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDKEIDRGSLNPGKQLFEKMVSGQ
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVTRLRTTVGVDGSLYKMH
PQYARRLQKTTRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQIKKRMRSEIEAGLRKKTHENAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVSCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKTTDCEGEDVVYLLREGIRRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNVEMVEGDQGRMCVNMEWGAFGDNGCLDD
IRTIYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISESLKTRG
IFETKFLSQIESDRLALLQVRTILQQLGLNGTCDDSIIVKMVCGAVSRRGAQVCGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKDLAPKCNVTFLLSEDGSGKG
AALITAVGCRLRDAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatagctgcccagcttctggcctatttcttcaccgaattgaaggatgatcagctcaaa
aagattgataaatatctttattccatgcggctctctgatgaaacactactggatatcatg
tctcgcttcaagagagagatgcacaatggtctttctagagacttcaatccaacagccaca
gtaaaaatgcttcctacatttgtaaggtcaattcctgatggctcagagaaaggagatttc
attgcattggatcttggtggatcttattttcgaattctgcgagtgaaggtctctcatgag
aaaaagcagacagtacaaatggaaactgagatttatgacacaccagaagatatcatgcat
ggcactggaacccggctctttgatcatgttgctgaatgcctgggagatttcatggagaag
caacaaatcaaggacaagaaattgccagttgggtttacattttctttcccatgtagacaa
tccaagctagatgagggtattctgataacctggacaaaacgcttcaaagcaagcggagtt
gagggagcagatgtagtaaagctgctcaacaaggcaatcaagaaacgtggggactatgat
gcagacatcatggctgttgtaaatgacacagtaggaacaatgatgacctgtgggtttgat
gaccagcgttgtgaagttggcttgattataggtactggcacgaatgcctgctacatggaa
gaattgaggcatattgatctggtggaaggtgatgaggggaggatgtgcattaacactgag
tggggagcctttggagatgatgggtcactagaagacatcagaactgagtttgacaaggag
attgaccgtggatccctcaatcctggaaaacaactgttcgagaagatggtcagcggacag
tacatgggtgagctggtcaggcttatccttgtaaagatggccaaagagggactactgttt
gaggggcgaatcactccagagcttttaaccaaaggaaaatttgaaacgaaacatgtgtct
gccatagaaaaaagcaaagaaggtctgaataaagccaaagaaattttgacacgtcttggg
gtagaaccatcccatgaagactgcattgctgtccagcacgtctgtacaattgtttcattc
cgttctgctaatctggtggctagtactctgggcgcgattctgaatcaattgcgtgataat
aaaggcgtaaccaggctgcgcaccacggtgggtgtggatggttccctttacaagatgcat
ccacaatatgccagacgcttacagaaaacaacgaggcgattagttcctgactctgacgtg
cgattccttctgtctgagagtggcagtggaaagggtgctgcaatggtcacagcagtagca
tacaggttgtctgagcagcacaggctgatagatgagactctggctgaattcaagcttact
catgagcagctgttgcagattaaaaaaaggatgcgatcagaaatagaagctgggctgagg
aagaaaactcatgaaaatgcaaaagtaaaaatgctgcctacctttgttcgcagcacacca
gatggaacagagaatggagattttctggctctcgatctgggaggaacaaacttcagagtt
ttgcttgtgaagatccgtagtggtaaaaggagaacagttgaaatgcacaataaaatatat
gctattcctatagaggtcatgcagggtactggagaagaactgtttgatcacattgttagc
tgtatctcagacttcctggattacatgggaataaaaggcgcacgacttccccttggcttt
acgttttccttcccttgcaagcagaccagtttagatgctggtatcctcctcaactggacc
aaaggctttaaaacaacagattgtgaaggagaggatgtcgtgtatttgcttagggaagga
attagaaggagagaggaatttgacttagatgttgtggcagtggtgaatgatacagttggc
actatgatgacttgtgcatatgaagatccaaattgtgaaataggactcattgttggcact
ggcagcaatgcatgttacatggaggaaatgagaaatgtagagatggtagagggagatcaa
ggacgaatgtgtgtgaacatggaatggggtgcgtttggagacaatggatgcctggatgac
atcaggacaatttatgacaaagctgttgatgattattcgttaaatgctggaaaacaaagg
tatgagaaaatgattagtggaatgtacctgggagaaatcgttcgcaatattctgattgac
ttcactaaaaggggattcctgtttagaggtcagatttcagagtcgctgaagaccagaggt
atctttgaaaccaagttcctttcacagattgagagtgacaggttagcattgcttcaggta
cgaacaatcctccagcagctgggcttgaacggtacctgtgatgacagtataattgtaaag
atggtttgtggagcagtatcgagaagaggagctcaggtctgtggagctggaatggctgct
gttgtagataaaataagagagaacagaggattagaccacctggatataacagttggtgta
gatgggacgctgtataaactacatccacacttttcaaggatcatgcaccaaacagtaaag
gatctcgcaccaaaatgcaatgtgacattcctcctttcggaagatggcagtgggaaagga
gcagctctcattactgctgtgggatgtagactgcgtgatgctgagcaaaactaa

DBGET integrated database retrieval system