KEGG   Chrysemys picta (western painted turtle): 101932285Help
Entry
101932285         CDS       T04662                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04010  MAPK signaling pathway
cpic04210  Apoptosis
cpic04625  C-type lectin receptor signaling pathway
cpic04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101932285 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101932285 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101932285 (MAP3K14)
   04672 Intestinal immune network for IgA production
    101932285 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101932285 (MAP3K14)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101932285 (MAP3K14)
Protein kinases [BR:cpic01001]
 Serine/threonine kinases: STE group
  Other
   101932285 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 101932285
NCBI-ProteinID: XP_008165797
LinkDB All DBs
Position
Un
AA seq 929 aa AA seqDB search
MAVMEIACQGAPDPTIGHQKELSATKGLSETVSEKQSSVCKVEDSEKVAFHSQWKILKDV
ITKGTAKEETEGGSASISIIAQAECENSQEFSPTFSERPFIADSKRYSRSDSLDQIPNNV
AHATEGKMAPACWRARHRGKGRKKRRKKRSRVRIQTLVSAKQGPRTPEQESCTPIPVQED
ETHQNTLFSNSSCFSEPCKDSICDQIPFEKPRKVLLVGKLHSLRNLHRPELHKLISPVQC
LNHVWKLHCQGDFVPQPETLHPFPYSPLCAMKPNPREINLLDDRACVNGERCFSGLSLEC
SLPKCVSQSLETNLDKLSVEEYLVDALKGSVSLGEPQNLASLAKTWRGGGLDLKEQFQET
DDNEGVLLTEKLKPVDYEYREEVHWTKCQDSLGVGSFGEVYKIEDKQTGFQCAAKKVQVE
HFRAEELTTCAGVTSPKVVPLYGAVKEGPWVTIFMELMEGGSLGQLIKQSGYLPEDRALS
YLGQALEGLEYLHAHHILHGDVKADNVLLSSDGSRAVLCDFGHSARLHPDGLGKCLVTGC
YMPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTRYYNHPLCLKIVKEPPP
LREIPPSCNRSTVEIIKAGLEKEPLKRASAAELKTKADIALQEVGDVKNPWREYREPRCL
SLDEKNNLHTSLSPTVSLISETLASPGSAPCLSQTLQPPSLELTEKTGVTPWNLCKELPR
ICDPLSLSSLAPVPTKSSSSSERATTISEQELQQLEIELFLNSLSQPYSLEEQEQMLSCL
SIDSPLMSDASEKNSLKASPSLRDTMSSGVHSWNSQTDGQSFSWNNLLYRSRHTDTPSYF
NGVKIQIQLLSGENLHIREFHRTKVGDIATGISSQIPASAFSLVTKEGQPVRYDMEVPDS
GIELQCTLAPDCSFGWTWRVKHGQLENRP
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaatggaaattgcatgccaaggagctcctgaccccaccatcgggcaccaaaag
gagctttctgctactaaagggctgagtgaaacagtgagtgagaagcagagcagtgtttgc
aaagtagaagattcagagaaagttgccttccacagtcaatggaagatcctgaaagatgtg
atcaccaaaggaacagcaaaagaagagacagaagggggttctgcatccatttccatcatc
gcccaggctgaatgtgagaacagccaggagttcagccccaccttttcagagaggcctttc
atagctgatagtaaacgttacagccggtcagacagtcttgatcaaatcccgaacaatgtg
gcccatgctaccgaagggaaaatggcaccagcctgctggagggcaaggcatcgcgggaaa
ggcaggaagaaacgtcgcaagaaaagatccagggtcagaatacaaacactggtctctgct
aagcaagggcccagaactccggaacaggaaagttgtacaccgatcccagtccaggaggat
gaaactcaccaaaacactctcttcagtaacagctcctgtttttcagaaccttgcaaggac
tcaatttgtgatcagataccatttgagaaacctagaaaagttctgctcgtaggcaaactc
cattcgctaaggaacctgcacagaccagaattgcacaagttgataagcccagtacagtgc
ctgaaccatgtttggaagctacactgtcagggtgattttgtgcctcagccagagactctc
catcccttcccttacagtcctctttgtgccatgaaacctaatcctcgggagattaatctc
cttgatgatcgggcctgtgtgaatggtgagcgttgcttttctggcctaagtttagaatgc
agcttaccaaaatgtgtcagccagtccctggaaaccaacttggacaaactttctgtggaa
gaatatttggtggatgctcttaaggggagcgtgagtctcggtgagccgcagaacttagcc
agcctggccaagacgtggagaggaggcggtctggatttgaaggagcagtttcaagagaca
gatgacaatgagggggtgctgcttactgagaaactaaagccggtggactatgaataccga
gaagaggttcactggaccaagtgccaggactctctgggtgttggctcttttggggaagtg
tacaaaatagaggacaaacagacgggatttcagtgtgctgccaaaaaggtgcaagtcgaa
cactttcgtgcagaggagttgacgacatgtgctggagtaacaagtcccaaagttgtccct
ttgtatggagctgtgaaggaaggtccttgggttactatcttcatggagctaatggagggt
ggctcactagggcagctgattaaacaaagtggctacttgccagaggatagagccctcagt
tacctgggtcaagcattagagggtctggagtatcttcatgctcaccacattctgcatgga
gatgtcaaagcggacaacgtgctcttatccagtgatggaagccgggctgtcctctgcgac
ttcggccactctgctcgccttcatcccgatggcttggggaagtgcttggtgacagggtgc
tacatgcctggcacagagactcacatggctccagaggtagtaatgggaaaacgctgtgac
tcaaaggtggatgtctggagcagctgctgcatgatgctgcacatgcttaatgggtgtcat
ccttggacccggtattacaaccaccctctttgcttaaagatagtcaaggagccacctcct
ttgagggaaatcccaccttcctgtaaccgttccactgtcgagatcattaaagcagggcta
gagaaggagccacttaaaagagcttctgcggctgagttgaagactaaggctgacatagct
ttgcaggaggtgggagatgtgaagaacccttggagagaatacagagaacctagatgctta
tctttggatgaaaaaaacaatctgcacacctccctgtccccaacagtcagcctgatttct
gagactttggctagccctgggtcagctccttgcctatcccaaaccttgcagccaccatct
ctggagctgaccgagaagactggggtaaccccttggaatctgtgcaaggagttacctagg
atctgcgatccactttccctctcctccctggctcctgtccccaccaagagcagcagctcc
tcagaacgggcaacaactatctcggaacaggagcttcagcagctggaaatagagttgttt
ttgaacagtctgtcacagccgtactctctggaggagcaggagcaaatgctctcgtgtctc
agcattgacagcccgctcatgtctgatgccagcgagaagaactctctgaaggcctctccg
agcctgagggacaccatgagctctggggttcactcctggaacagccagaccgatggacag
agcttcagctggaacaacctgctgtatcgcagtcggcacacggacacccccagctatttc
aatggagtgaaaatccagatccagttgctaagtggagaaaatcttcatatccgagagttc
cacaggaccaaggtgggagacattgctactgggataagcagccagataccagcctctgct
ttcagccttgttacaaaggaaggtcaacctgttcgctatgacatggaggttccggactcg
gggatagagctgcagtgcacccttgctcctgactgcagtttcggttggacctggagagtc
aagcatggtcagctggagaatagaccatga

DBGET integrated database retrieval system