KEGG   Chrysemys picta (western painted turtle): 101932764
Entry
101932764         CDS       T04662                                 

Gene name
BRSK1
Definition
(RefSeq) BR serine/threonine kinase 1
  KO
K08796  BR serine/threonine kinase [EC:2.7.11.1]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101932764 (BRSK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpic04131]
    101932764 (BRSK1)
   03036 Chromosome and associated proteins [BR:cpic03036]
    101932764 (BRSK1)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101932764 (BRSK1)
Protein kinases [BR:cpic01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   101932764 (BRSK1)
Membrane trafficking [BR:cpic04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101932764 (BRSK1)
Chromosome and associated proteins [BR:cpic03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101932764 (BRSK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 101932764
NCBI-ProteinID: XP_008175143
LinkDB
Position
Un
AA seq 565 aa
MRRRTGKCLSSQAALGPKGEINQGSQRLVKLGVHCITGQKVAIKIVNREKLSESVLMKVE
REIAILKLIEHPHVLKLHDVYENKKYFHRDLKPENLLLDEKNNIRIADFGMASLQVGASL
LETSCGSPHYACPEVIKGEKYDGRRADMWSCGVILFALLVGALPFDDDNLRQLLEKVKRG
VFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQIQKHPWFLGGKNEPEPEQPVPRKVSIRR
IQSVSELDPDVLESMYSLGCFRDKGRLQQELQAEGQPHHGPRTAAQRGHIPHSPRPRSLA
DPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQHSQRSRSVSGAST
GLSSSPLSSPRPPSLPRLAKKSWFGNFISLEKEELIFVVIRDKPLSSVKADIVHAFLSIP
SLSHSVLSQTSFRAEYRASGGPAVFQKPVRFQVDISASEGGAAPKDSGVFSVSFTLISGP
SRRFKRVVETIQAQLLSSHDQPSVQALADEKNGQQPRPPGTPTRVAQNSRRSDPDVSEQP
RRGSCKEKKLVSSNGTQAPQPPQQP
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcgccggcgaacggggaagtgcctgagctcccaggcggcgctggggccgaagggcgag
atcaaccagggatcccaacggctggtgaagctgggcgttcactgcatcacggggcagaag
gtggccatcaagatcgtgaaccgggagaagctgtcggagtcggtgctgatgaaggtggag
cgggaaatcgccatcctgaagctgatcgagcacccgcatgtgctgaaactgcacgatgtc
tacgagaataagaaatatttccaccgtgacctcaagccggagaacctgctgctggacgag
aagaacaacatccggatcgcggacttcgggatggcgtccctgcaggtcggggccagcctg
ctggagaccagctgtggctctccccactatgcatgtcccgaggtgatcaagggtgagaaa
tacgatgggcgccgggccgacatgtggagctgcggggtcattctctttgccctgctggtg
ggggcactgcccttcgatgacgacaacctgcgacagctgctggagaaggtgaagcggggg
gtcttccacatgccccacttcatcccccccgactgccagagcctcctgcgcggcatgatc
gaggtggagccggagaaacggctcagcctggagcagatccagaagcatccctggttcctg
ggcgggaagaacgagccggagccggagcagccggtgccgcggaaggtgtcgatccggcgc
atccagtcggtgagcgagctggaccccgacgtgctggagagcatgtactcgctcggctgc
ttccgcgacaaggggcgactccaacaggagctgcaggccgagggccagccgcatcacggc
ccacgcaccgcagcccagaggggccacatcccacactcaccccgcccccgttccctggca
gaccccccccggaagcgggtcgactcgcccatgctgaaccgccacgggaagcggcggccc
gagcggaagtccatggaggtcctgagcgtcaccgacgggggctccccggtcccagcccga
cgggccatcgagatggcccagcacagccagaggtctcgctccgtcagcggtgcctccact
ggcctctcgtccagcccgttgagcagccccaggcccccgtctctccccaggctggcgaag
aagtcctggttcgggaatttcatctcgctggagaaggaggagctgatattcgtggtgatc
cgggacaagccgctcagctccgtcaaggccgacatcgtccacgccttcctctcgatcccc
agcctaagtcacagcgtcctgtcccagacgagcttccgggccgagtaccgggcgtccggg
ggcccggccgtcttccagaaacccgtccggttccaggtggacatcagcgcctcggagggg
ggggccgcccccaaggacagcggggtgttctccgtcagcttcaccctcatctcaggtccc
agccgtcgattcaagcgggtcgtggagacgatccaggctcagctgctcagttcccacgac
cagccctcggtgcaggccctcgccgacgagaagaacgggcagcaaccgcgccccccgggc
acccccacccgcgtggcccagaattcccggcgctccgaccccgacgtctcggagcaacct
cgccgcggctcgtgcaaggaaaagaaactcgtgtcgtccaacgggacgcaggccccccag
cccccgcagcagccgtga

DBGET integrated database retrieval system