KEGG   Chrysemys picta (western painted turtle): 101932947Help
Entry
101932947         CDS       T04662                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00052  Galactose metabolism
cpic00500  Starch and sucrose metabolism
cpic01100  Metabolic pathways
cpic04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101932947
   00500 Starch and sucrose metabolism
    101932947
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101932947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpic04147]
    101932947
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101932947
Exosome [BR:cpic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101932947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101932947
NCBI-ProteinID: XP_008162911
LinkDB All DBs
Position
Un
AA seq 938 aa AA seqDB search
MSRGDSTWKMKSYQKLATDIPQPTESYAEEESIDGKPPCLRKLSTWWLGVGLLMIVAGLL
SGVTMWMLRQVSGSQHGQTPLEKCSAVPEPLRFDCYPERNVVVTKELCESRGCCFIERDQ
PLGSRSGVPWCFYPPDFPSYTLESLNQTELGMVGLLRRKVKAYYPRDIERLQLSVEFETD
TRLHIKITDSTSPRFEVPLEVPRAMKKAENPVYSLEFSKEPFGLLLRRRASGAVLLNTTV
APLIFADQFLQISTILPSKFLYGLGEHRSSFLHSLDWSTLTLWARDVPPTESYNLYGAHP
FYLLMEEEGAAHGVFLLNSNAMEVALQPAPALTWRTIGGVLDFYIFLGPDPNMVIQQYQQ
VIGFPAMPPFWGLGFHLCRWGYGTSNATWQIVKAMRNYQIPQDAQWNDIDYMEGYRDFTF
DPEKFDTLPQLVEDLHKHGQYYVMILDPGISSTNPPGSYWPYDEGLRRGIFINTTQGQTL
IGQVWPGLTAFPDFSNPDTYQWWLENLNRFHARVPFDGLWIDMNEPSDFKDGSVDGCSPG
ELDNPLYVPAVLGGSLSAKTVCASAKQSASMHYNLHNLYGLMEAKATASALIQIRGKRPL
VISRSTFPSQGRYSGHWLGDNRSKWKEMYWSVPGVLSFNLFGIPLVGADICGFSGTTSEE
LCTRWMQLGAFYPFSRNHNTQNEKAQDPVAFGSVARTAMKEVLLTRYALLPFLYTLFHRA
HLQGHTVARALFFEFPQDVITYSIDKQFLWGQSLLVTPVLEPGVDSVIGYFPRGVWYDYY
TGSSLNSSGESLKMAAPLDHINLHVREGAILPTQKPGSTSWVSSGNPLRLIAALSQNASA
WGDLFWDDGESLDTFERGDYSYLVFNVTQNVFTSTVLHANVEATYITVDVLSVYGVREKP
SRVTVNGKENPFSYLDNQVLTVSDLNLNLSQGFSIRWL
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaggagacagcacatggaagatgaagtcctaccaaaagctggcaacagacatc
ccacagcctacagaatcctatgctgaagaagagagcattgatgggaagccgccctgcctt
cggaagttgtccacttggtggctgggtgttggcctgctgatgattgtagctggcctgctg
agtggagtcaccatgtggatgctcagacaggtgtctgggagccagcatggacagacgccc
ctggagaaatgcagcgctgtccctgagcctctccgctttgactgctaccctgagaggaac
gtggtggtgacaaaagagctctgtgagagcagggggtgctgctttattgaacgtgaccag
cctttggggagcaggagtggagtgccctggtgcttttacccccctgacttccccagctac
actctggagagcctgaaccagactgagctgggaatggtgggtttgctgaggaggaaggtg
aaggcctattatcccagagacattgagaggctgcagctgagcgtggagtttgaaacagac
actcggttacacatcaagatcacggattccacaagccctcgatttgaagtccccctggag
gttcctcgggcaatgaagaaagcagagaatcccgtatacagcctggagttctccaaggag
ccttttggtctgctgctgaggcggagagcctctggcgctgtgctgttaaacacgaccgtg
gctcccttgatcttcgctgaccagtttctccagatttcgaccatcctcccttccaaattc
ctctatggcctcggggagcatcggagtagcttcctgcacagcctggactggagcaccctg
acgctgtgggcccgggatgtccctcccacggagtcatacaacctctatggagctcaccca
ttttacctgctgatggaggaagagggagctgctcatggtgttttcctcctgaatagcaat
gcaatggaggtggctctgcagccagctcctgccttgacctggagaaccattggaggagtt
ctggatttttacatcttcttgggtccagatcccaacatggtcatccaacagtaccagcag
gtgataggtttccctgccatgccacctttctgggggctggggttccatctttgccgctgg
ggctatgggacaagcaatgcaacctggcagattgtgaaagccatgaggaattatcagata
ccacaggatgctcagtggaatgatattgattacatggaagggtaccgggacttcaccttt
gatcccgagaagtttgacaccctcccgcagttggttgaagaccttcacaagcatggccag
tactacgtcatgatcctggatcctgggatcagcagcactaatcctcctggttcttattgg
ccttacgatgaaggcttgagacgtggcatattcataaataccactcaggggcaaacgctg
attggacaggtgtggcctggcctcactgctttccctgacttctccaacccagacacttac
cagtggtggctggagaatctgaaccggttccatgctcgcgtcccctttgatgggctttgg
atcgacatgaatgaaccatccgacttcaaggacgggtcagtggatggctgttccccaggg
gaacttgataaccctctctacgtgcctgccgtgctgggcgggtccctctctgcaaagacg
gtgtgtgcctcggcgaagcagagcgcctccatgcactacaacctccacaacctctacggg
ctgatggaagccaaagccacagctagcgccttgatccagatccgagggaaacgcccgctt
gtgatttctcgctccaccttccccagccagggcaggtattcgggacactggctcggtgac
aacaggagcaagtggaaggagatgtactggtccgtcccaggggtgctgagcttcaatctc
tttgggatcccgctggttggggcggacatctgtgggttctcaggcaccacctcggaggag
ctatgcacccgctggatgcagcttggagccttctaccccttctcccgaaaccacaacacc
cagaatgaaaaggcccaggatccggtggcgttcggctcggtggcgcggacggccatgaag
gaggtgctgctgacgcgctacgccctgctgcccttcctctacacgctcttccaccgggca
cacctgcagggccacaccgtcgctcgagccttgttctttgagtttccacaggacgtgatc
acgtactcgattgacaagcagtttctgtgggggcagagcctcttggtgacgcctgtgctg
gagcctggagtggactctgtgattggctacttccccagaggggtgtggtacgattactac
acgggctcttctttgaacagcagtggggagagcctgaagatggctgctccgctggaccac
atcaacctgcacgtccgggagggcgccattctccccacccagaaacccgggagcaccagc
tgggtgagtagcgggaaccccctgcgcctgatcgcagccctgtcccagaatgccagcgcc
tggggggacctcttctgggatgacggcgagagcctggacaccttcgagaggggtgactac
tcctacctggtgttcaacgtcacgcagaacgtcttcacctccactgtccttcacgccaac
gtggaagccacctacatcactgtggacgtgctgagtgtctatggggtccgggagaagccc
agcagggtcactgtcaacggcaaagagaatcccttctcctacctggacaaccaggttctc
acggtgagcgacctcaacctcaaccttagccagggattttccatccgctggttgtga

DBGET integrated database retrieval system