KEGG   Chrysemys picta (western painted turtle): 101933626
Entry
101933626         CDS       T04662                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04010  MAPK signaling pathway
cpic04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101933626 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101933626 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cpic04052]
    101933626 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:cpic00536]
    101933626 (FGF1)
Cytokines and growth factors [BR:cpic04052]
 Growth factors
  Growth factors (RTK binding)
   101933626 (FGF1)
Glycosaminoglycan binding proteins [BR:cpic00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101933626 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101933626
NCBI-ProteinID: XP_005302905
LinkDB
Position
Un
AA seq 155 aa
MAEGEITTFTALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGKVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTESGQFLAMDTNGLLYGSLLPGEECLFLERMEENHYNTYTSKKHADK
NWFIGLKKNGSCKLGPRTHYGQKAILFLPLPVSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgaaggggaaataacaacgttcaccgccctgaccgaaaaattcaatcttccactg
gggaactacaagaagcccaaactcctgtattgcagcaacggaggctacttcttgaggata
cttccagatggcaaagtagatgggacaagggaccgaagcgaccaacacattcagctgcag
ctaagtgcggaaagcgtgggtgaagtatatataaagagcactgagtctggacagtttttg
gctatggataccaatggacttttatatggatcactgttaccgggtgaggaatgcttgttc
ttggaaagaatggaagaaaatcattacaacacgtacacgtctaagaagcatgcagataag
aactggttcattggtttaaagaagaatggaagttgcaaactgggaccgcggactcactat
ggccaaaaggccatccttttccttcctctgcccgtgtccgctgattaa

DBGET integrated database retrieval system