KEGG   Chrysemys picta (western painted turtle): 101933763Help
Entry
101933763         CDS       T04662                                 

Gene name
LCT
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00052  Galactose metabolism
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101933763 (LCT)
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     101933763 (LCT)
    3.2.1.108  lactase
     101933763 (LCT)
Chaperones and folding catalysts [BR:cpic03110]
 Intramolecular chaperones
  Others
   101933763 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 101933763
NCBI-ProteinID: XP_008176814
LinkDB All DBs
Position
4
AA seq 1945 aa AA seqDB search
MDLGCKAVLIFLVFSPCCGVDWKLVQDFIAIAGPLNNELVSNLNLQNKLLGKEALNSVVD
EGHNSLCHQPFLASLPQYFSYLHASGVTHYKIFMPWIHILPEGNAKNPEEATVQCYRQLL
ESLTAANLKPVIILQHKHLPGVVITQSKLGKHRTFADLFVEYAEFNFRSFGDMVDMWLTF
SDLPEIIESLPYDDPQTSLQILAAAHEKAYKIYHEKYSSKDGKLSIALEIDHVFGSAALE
SFLASLRDSVDFLSLSLQYNCRKEVDLKRKLNELQTIKENTKVLLFDLKLHECNSMKENP
FITVASIFQAINQYKVLTMGYDVNEFLNYSSVHKIRYTVFVPXVKSCKLSSNTTIQKRLQ
EGPAAALAPLSSYQTVWETFANQSELERDTFVHDVFPSGFLWGTSTGSFNVEGGWAEDGK
GESIWDWFGQQGHVHMNQTANVACDSYHKIDYDVYLLRGLQSKLYKFSISWARIFPTGIR
NSFSPQGVNYYNKLINRLLESNIEPMVTLFHWDLPQTLQDLGGWQNESIIDTFADYADFC
FATFGDRVKFWITFHEPWVISYAGYGTGQHPPGITDPGVASYKVAHSIIKAHAKAWHLYD
DRYRSQQHGKVGIVLNSDWAEPKTPTSSEDVKAAERYMHFMLGWFAHPIFVNGDYPDILK
SQIQQKNQQCSIPVAILPSFSEEEKSIVKGTADFFGLSHYTSRLISTAVNDTCIPAYENV
VNFSQHVDPSWPQTASSWIRVVPWGLRRLLKFVSQEYTGTRIPIYIAGNGVPTEDGGDVI
NDTKRMDYFRLYINEALKAIKLDAVDVQTYIARSLIDGFEGPMGYSQLFGLHHVNFEDGN
RQRTPKESAYFFSSVIEKNGFPKEVMDRSLQSLTCDSPPPPKLLSLPASDVPSKAKVVWE
KFSPQTKFERDMYFYGTFPDDFTWGVSSSAYQIEGGWDEDGKGPSIWDNFTHIPGKVNNN
ETGDIACDSYNKLAADLYMLTALRVKSYRFSLSWPRIFPSGRNDSINSHGVDYYNRLING
LTARNITPMVTLYHWDLPQALQDIGGWENDLLIELFDSFADFCFQTFGDRVKFWMTFNEP
FVIAWAGYGLGEFPPNVKDNPGHTPYKITHTLLKAHARVYHTYDRKYRVSQKGVISLSLS
VEWVEPKTLDDPRDVEAADRYLQFRLGWFAHPIFKNGDYPEVMKWTVGNRSELQNLPSSR
LPAFTAEEREYIRGTADVFCFNTYTSKIIKHKTTRLKPFSYEDDQERLEEVDSSWPTSAI
SEMRAVAWGLRRLLNWIKEEYGNPPIYVTENGVGTQTKSDVDDTNRIFYYKTYINEALKA
YKLDGVNLRGYIAWSLMDNFEWLHGYSARFGLHQVDFENPNRPRTPKRSAVYYAEVIRNN
GIPLPKEDEFLYGEFPKNFSWSVATAAYQIEGAWRADGKGLSIWDQFAHTPLKISNDENA
DVACDSYHKLEKDLASLKALQVSHYRFSISWPRVLPDGTTKRVNEAGLNYYERLIDALLA
SNIKPQVTIYHWDLPQALQNVGGWENETIVQRFKEYAELLFQRLGDKVKFWITLNEPYII
ANLGYGYGTSAPGIFARPGRAPYIVGHNLIKAHAEVWHLYNETYRPKQGGLISITINSDW
AEPRNPDKQEDIDAAKRYVQFYGGWFAHPIFKNGDYNEVMKTRIWERSLAQGLSKSRLPE
FTESEKQRIKGTFDFFGFNHYTTILAYNLNYASAISSYDADRGVASVTDRSWLGSGSFWL
KVTPFGFRKILRWIKEEYDNPPIYVTENGISERGDLGLNDTWRIHYYKSYINEALKAVVL
DGVDLRGYTAWSLMDNFEWATGFAEKFGLYYINYTDPNLPRIPRESSKYYSSIILCNGFP
DPANGPHLCLQPQPEGTTAPTASTMGSMHSASSGKVQFLGLGLTSLNAEIGLYVLFAFAL
IGVLGLVLFSYKYGKLSKRVNKPSG
NT seq 5838 nt NT seq  +upstreamnt  +downstreamnt
atggatctaggttgtaaggcagtgttaatttttcttgtcttttctccttgttgtggggta
gactggaaactagttcaggattttattgccattgctggtcccctaaacaacgagttagta
agcaatttaaatcttcagaacaagctcttaggcaaagaagctcttaatagtgtagtggat
gaaggacataatagtttgtgccaccagccttttttggcttctctgccacagtacttctcc
taccttcatgcaagtggtgttacgcattataaaatttttatgccatggatacacatccta
ccagaggggaatgccaagaatccggaagaggctacagttcagtgctatagacaacttctt
gagtctcttactgctgcaaaccttaagccagtgataattctgcaacataagcatttgcct
ggggttgtgatcacgcagtccaaacttgggaagcacaggacctttgctgacctctttgtg
gaatatgctgaatttaacttccgttcttttggtgatatggttgacatgtggctcactttt
agcgacttgcctgagatcattgagagtctgccgtatgatgacccacagacctctctccag
attctagctgctgcgcatgaaaaagcttataaaatctaccatgaaaaatattcttcaaaa
gatggaaaactgtccattgcactggaaattgatcatgtctttgggagtgcagcattggaa
tcttttttagcctctcttagggactctgtcgattttctctccctcagcctgcaatacaac
tgtagaaaggaagtagacttgaaaaggaagttgaatgagttacagactatcaaggagaat
acaaaagttttactctttgatctaaaacttcatgaatgtaactccatgaaagagaatcca
tttataacagtagctagcattttccaggcaattaatcaatacaaggtcttgacaatggga
tatgatgttaatgaattcttaaactactcatcagttcataaaattaggtacacagttttt
gttccttaagtgaagtcttgtaaactctcatctaatacgactatccaaaaaagactacaa
gagggcccggctgctgctcttgctcctctctcctcctatcaaacagtttgggaaactttt
gctaaccagtctgaattggagagagacacttttgtgcatgatgttttcccaagtggtttc
ctctggggcacatccactggttcctttaacgttgaaggaggctgggccgaggatggaaaa
ggagagagtatttgggactggtttgggcagcaaggtcatgtccacatgaatcagaccgca
aatgtggcgtgtgacagttatcacaaaattgactatgatgtttacctgctcaggggtctt
cagtcgaagctgtataagttttctatatcctgggccaggatttttcccactggcattaga
aacagcttcagcccccaaggtgtaaattactacaataaattgataaaccgcttactggaa
tctaatattgagcccatggtgaccttgttccactgggacctcccacaaacactgcaagat
ctcggtggatggcagaatgaaagcattattgatacttttgcagactatgcagacttctgc
tttgccacctttggggatcgggttaaattttggattaccttccatgaaccttgggtcatt
agctacgctggctatggcactggacagcatcccccgggaatcactgatccaggagtagca
tcttataaggtggctcactcaattattaaggcgcatgcaaaagcctggcacttatatgat
gaccgatatcgttcccaacagcatggtaaggtgggaattgtgttgaattcagattgggct
gaacccaagaccccaacaagttctgaggatgtgaaggcagctgagcgctacatgcatttc
atgctaggctggtttgctcaccctatatttgttaatggagactatccagatatcctgaag
tcccagatccaacagaagaaccagcagtgctctatcccagttgccatcctcccttcattt
agtgaggaagagaagtccatagtgaaaggaactgcagatttctttggtctttctcattac
acttccagactgatcagcactgcggttaatgacacctgtattccagcctatgagaatgtt
gtgaacttttcccaacatgttgatccttcttggccacagactgcctcatcttggatcaga
gtggtcccttgggggctgagaaggctgttgaagtttgtttcccaggaatatacagggact
aggatcccaatttacatagcagggaatggtgtgcccacagaagatggaggggatgttatt
aatgacacgaagagaatggattatttcaggctgtacatcaacgaggctctgaaagctata
aagctagatgcagttgatgttcagacatatattgcccgatccctgattgatggctttgaa
ggaccaatgggttacagtcaactatttggactacatcacgtgaattttgaagatggcaac
agacaaaggacaccaaaggagtcagcatatttcttctccagtgttattgaaaagaatggt
ttccccaaagaagtcatggacagatctcttcagtcactgacgtgtgattcgcccccacca
ccaaagttactcagtttaccagcgtctgatgtaccttcaaaggcaaaagttgtttgggaa
aaattctcaccccaaactaagtttgaaagggacatgtacttctatggaaccttcccagat
gattttacatggggtgtgtcctcctctgcctaccagattgaaggaggttgggatgaggat
ggcaaagggcctagcatttgggataacttcacccacatcccagggaaagtaaacaataat
gagactggagatatagcttgtgatagctataacaaactagctgcagatctttacatgctg
acagctttaagggtaaagagctatcgcttctctctgtcttggcctcgcatttttcctagt
ggaagaaatgattccataaatagccatggggttgattattacaaccgacttatcaatggt
ttgactgcaagaaatatcactcctatggtcactctgtaccactgggatctgcctcaggct
ctccaggacattggtggctgggagaacgatttattgattgaactttttgatagttttgca
gacttctgtttccagacttttggagacagagtgaaattttggatgacctttaatgaaccc
ttcgtcattgcatgggctggatatgggttaggagaatttccaccaaatgtgaaggataat
ccaggtcacactccctataagattacacacacgttactaaaagctcacgccagggtttac
catacgtatgaccgtaaatatagagtcagtcagaaaggggttatttctttgagcctcagt
gttgagtgggttgaaccaaagacactggatgatcccagagatgtggaagcagcagatcgc
tatctgcagtttaggctagggtggttcgcacacccaattttcaaaaatggggactaccca
gaggtcatgaaatggacagtagggaacaggagtgagctacagaacttgccatcatcccgt
ctgccagctttcacggcagaggagagagaatacatcaggggcacagccgatgtcttctgt
ttcaacacctacacctccaaaattataaagcataagaccaccaggctaaaaccattctct
tatgaggatgaccaggagcgattggaggaggttgattcatcctggcctacctcagcaatt
tcagaaatgagagctgtagcctggggtctcaggaggctgctgaattggattaaagaggaa
tatggcaatcccccaatttacgtaactgaaaatggggtgggaacacagaccaaatctgac
gttgatgacacgaaccggatattttactacaaaacatacatcaatgaagctctgaaagcc
tacaagttggatggcgttaatcttcgaggatacattgcttggtctctcatggacaacttt
gaatggttgcatggttacagtgccaggtttggactgcaccaagttgattttgaaaatccc
aacaggccaaggacccccaaacgctctgctgtgtactatgctgaagtcatacgtaacaac
gggatcccattaccaaaagaggatgagtttttatatggggaatttccaaagaatttttca
tggagcgtagcaaccgcagcatatcagattgaaggagcctggagagcagatgggaaagga
cttagcatttgggaccagtttgctcatactcccttgaaaattagcaatgatgaaaatgca
gatgtagcttgtgacagctaccacaagcttgagaaggacttggctagtctgaaagctctc
caagtgtctcactatcgcttttcaatttcctggccccgtgttctcccagatggaactaca
aagcgtgtaaatgaagctggattaaactactatgagaggcttattgatgctctccttgca
tctaatattaaacctcaggtaactatttaccactgggacctccctcaggccctgcagaat
gttggcggttgggagaatgaaactatagttcagagatttaaagaatatgctgagttactt
ttccagaggctgggagataaagtgaaattttggataaccctcaatgaaccctatataatc
gcaaatcttggctatggctatggcacatctgctccaggaatctttgctagaccaggtaga
gctccttacatagtagggcataacttaataaaggcccatgctgaagtctggcatctgtac
aatgaaacctaccgtcctaaacaaggaggattaatctccattaccattaactctgactgg
gctgagccaagaaaccctgacaagcaggaagatattgacgctgcgaagcgatatgtgcag
ttttatggtggttggtttgctcatcccattttcaaaaacggcgattacaatgaagtgatg
aaaacgaggatatgggagcgcagcctggctcaagggctgagcaaatcacgactcccagaa
tttaccgaaagtgaaaagcagagaattaaaggcacatttgatttctttggtttcaatcat
tataccacaatattggcatacaacttaaactacgcttctgccatctcatcctacgacgct
gataggggggtagcttcagtaacagaccggagctggctgggctctggttccttctggcta
aaggtgaccccctttggcttcagaaagatcctgaggtggataaaagaggagtatgataac
cctccaatttacgttactgagaatgggatttctgaacgtggagaccttggcctcaatgac
acttggcgaatacactactacaagagttacattaatgaagcattaaaagctgttgtactt
gatggtgttgatctccgaggctacactgcatggtctttgatggacaactttgaatgggca
acaggctttgctgaaaaatttggtttgtattacatcaactacaccgatcccaatctgccc
aggattcccagagaatcttcaaaatattattcatcaatcatactatgtaatggtttccca
gacccagcaaatggaccacatttgtgtctccagccacagcctgaaggtactactgcacca
actgctagcacaatggggtctatgcacagtgcgtccagtgggaaagtacaatttttggga
ttaggtttaacttcactgaatgcagaaataggactctatgtgttatttgcttttgctcta
attggtgtgttaggacttgtgcttttttcatacaaatatggcaagttatccaaaagagtg
aataaaccatcaggatag

DBGET integrated database retrieval system