KEGG   Chrysemys picta (western painted turtle): 101934276Help
Entry
101934276         CDS       T04662                                 

Definition
(RefSeq) collagen alpha-1(XIX) chain-like
Organism
cpic  Chrysemys picta (western painted turtle)
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_3 Laminin_G_2 Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 101934276
NCBI-ProteinID: XP_008163575
LinkDB All DBs
Position
Un
AA seq 348 aa AA seqDB search
MEKRTVYQISSVPWNRAGTWVLACVFLAVQSFLVNGQEHSGYHSGDEDTYRKIAAESYPY
LPELGSTSYDGYKSGDDFRMTSTSIPFLTDYPGRYYPEETTAGYYASSSSGYYPDREKHT
FPTKYYVDARDDTTLTVKTSFSEEKNLFPVPEISREAQVTDLLEELEVHRASGVSIVPGS
QSDLTAYQLGPSVQVRRETRFILPYGFPQEFSVVSTFRMREDTSEVVWDLWEVMDREGAD
QFRLRLYGESYAVDIYNAAGAATGSELTTFENLEKLFDGAWHKLALYARRHHITLYVDCQ
QVGTAPVTHDGAIRTDGDSVLARRIKDDVTPLVSTKPCTLLYIDLSLT
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagaactgtctaccagatttcatctgtgccatggaacagagctgggacatgg
gtacttgcctgtgtctttcttgctgtgcagtcctttcttgtcaacggacaagagcactct
ggataccattcaggtgacgaagacacctataggaaaatagcggcagaatcatacccttat
ttgcctgaattaggaagtacatcttatgatggctataaatcaggagatgatttcaggatg
acatccacaagcatccctttcctcacagactatcctggtagatattacccagaggaaacc
acagctggatattatgcgtcgtcatcttcaggttattacccggacagagagaaacacact
ttcccaacaaaatactatgttgatgctagagatgatacaactttgacagttaagacatca
ttcagtgaagagaaaaatcttttcccagttcctgaaatctcaagagaagcacaagtcact
gatctattggaagaactagaagtacacagggcttctggagttagtattgttcccggatca
caaagcgacctgacagcttatcagcttggaccaagcgtgcaagtcagaagagaaaccaga
tttattctcccatatgggttcccccaggaattctctgtagtctccaccttcagaatgaga
gaggacacctcagaggtggtctgggatctgtgggaagtgatggacagagaaggtgctgat
cagttcaggctgcgtctgtatggtgagagctatgcagttgacatatataatgcagcagga
gcagcaacaggtagtgagctcaccacctttgagaacctggagaagcttttcgatggggca
tggcacaagctcgctctgtatgccaggagacaccatattactttgtatgtagattgccag
caagtgggcacagcccctgtcactcatgatggagcaatcagaacagatggagatagtgtt
ttggccaggagaataaaggatgatgttactccgctggtaagtaccaagccatgcacctta
ctatatatagatttatccttaacctag

DBGET integrated database retrieval system