KEGG   Chrysemys picta (western painted turtle): 101934288Help
Entry
101934288         CDS       T04662                                 

Gene name
KMT2D
Definition
(RefSeq) lysine methyltransferase 2D
  KO
K09187  histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cpic00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101934288 (KMT2D)
Enzymes [BR:cpic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101934288 (KMT2D)
Transcription factors [BR:cpic03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101934288 (KMT2D)
Chromosome and associated proteins [BR:cpic03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101934288 (KMT2D)
   HMT complexes
    MLL-HCF complex
     101934288 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC FYRN PHD SET HMG_box
Motif
Other DBs
NCBI-GeneID: 101934288
NCBI-ProteinID: XP_008172100
LinkDB All DBs
Position
Un
AA seq 4549 aa AA seqDB search
MLLEPEELGPATPMEVYGTGGKLLERGEEVGPEPPILRPRPTLIKSDIVNEISNLSQGDT
RSSFPGSEPLLGSPDPEGGGSLSMELGMTSTDSLQKDDAGSLPHCTDSLAETDDSLLFEP
GAGAKGEGEKGRRRSSPGRSRIKQGRSSSFPGRRRPRGGTQGGRGRGRARLKSTTSSIET
LALADIDSSPSKEDDEEEDDTMQNTVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACS
QCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGKASDPSRLLLCDDCDISYHTYCLD
PPLHTVPKGGWKCKWCVCCVQCGAGSPGFHCEWQNNYTHCAPCASLVTCPVCRVKYVEDD
LLIQCRHCDRWLHAVCNNLFTEEEVEQAADEGFDCSSCQPYVVKPVVPVAPPEIIPVKIK
EPEPQYFRFEGVWLTETGMAVLRNLSMSPLHKRRQRKTRLGTLNGEGGLEGGDPLGTDEK
KDGDLDGDDLLKGEVGVEHMECEIKLEAAASPDRDGGADVDSGKGLEDSEECKKRKRKPY
RPGIGGFMVRQRKSHTRLKKGSAALVEACREVLSAEGHPEDGAPAEIPAEGAAEQGATEG
DEKKKRRGRKKSKLEDMFPAYLQEAFFGKALMDLSRKALLAAGGVGDGAACPPFGQGAPR
PRVDPGVPGTLQRVPGDGKETPAHLKGDDSMDSSALVAQEEDPKGAEVKAEDPGAEEPKG
SPDPGDSEKPATPGEGALSSDLDKIPTEELPKMESKDIQQLFKDVLGSAEREQQLNCVAA
GMEAGMGGRDPNRAQLSQRPFLQGSVSLGSLSSTVPMESYSGVCQSPFLDNRERSGFFSP
DHCEPESPWASSSAATTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGELSTISPVLY
ANMNFPSLKQDYPDWSSRCKQIMKLWRKVPAPDKAPYLQKAKDNRAAHRINKVQKQAESQ
INKQTKGEVLRKPERPSLHLRIPPQQGALPGAAGQPVYINSPVALPGSADGFLKSPAGAE
AAAESSEVFLKLPSQSPAQVPSHDPYSYPLEPRFPSPLGQSPTAGAAFQPFPTQQQQLLP
TPRPALGPQPPEFHPTSPGTPRHQPSTPDPFLKPRCLSGSLDNLSVPGSPGARPPEPLLS
PPPFGEQKRSLEAGGLQVKKEEGGPGVCSPGYMAAMGYADSPSHLSSAELKAADVFKAPL
TPRVSQVEPQSPGLAHPHPQALAPSPPSHPDLYRQSPSVSCYSDPYAQPPLTPRPQPPDS
CCALPPRSLPSDPFSRVPASPQSQSSSQSPLTPRPLSNEACCQSPVTPRFQSPDPYSRPP
SRPQSRDPFAPLHKPPRPQMPDSGFKSIPISHNPPAGGGFPPAQPSDPHSKGPGSQQPPF
ARSPGASVFAGAQAQMRFTFPSAVSEPLKGSPSHQPHGMNSHFASSQPMGKPQSANYASS
PGFHQAGSPLGPGNCPAETYTLSPLRPPSVLPQQPPHPQQQQDGSLTYLPRAGMAPPADK
RDEVVSGISALPSRELPELPVSQEGAVSSISQSELEKQRQRQRLRELLIRQQIQRNNLRQ
EKESAAAATSSSQAAWSAEASSQAFEQLRGLAPYQPAQDKSALGNLPAAPGSSKLSGPAM
VPAAFAPDERLSRPPPAATPSAMDLNGRPSVGAPQTFFPRGMFQGPSPQQQQMWQQQQAA
AVRLPGPARFQQPPGHELSRPALGGLAGRMAGPAEQIPSSPGAVGAQFIELRHNAQKGAA
GGMGSPFAQQGPPARPRFFLPGDESSSQALRASVMPLPAPVLQPQKLPAPLPPSATSPQG
AERSHQPPPKSGPPVPPPPSGLELQHGPPRPLSSSGSGLRPDGPKDSPAMEPPLAPVPAP
APSKSHLALEGGRLPCEVPVEPDLDDDFDSHKDLEDDDLANLSLDPDVAKGDDDLGNLDN
LETNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLRLVESANEKAEREALLKREP
AGPCPKGPGEPKELAPPREGLLPAPCPSSTAPAPHPTFKAQASILEAKPASLPSSVQPKL
EEGCLKTSPCQFNTGASDRLPVPVKSEALQGAEKMAASLGLTLKSGQNLLSAGAGPVRLG
TAPFPNNSQAATSGSDKGPYAAPGRGLAPGQSPALLELGGGALGLANAQHSQADDLEKME
SSLVASELPLLIEDLLEHEKKELQKKQQMSAHLPGGAQHLQTVQQQQQHSVLAHPAGPAQ
PPDGQAPRLVGPQQQLQLGLIARQQNLVPTQQLMTQQQRVVGPQQGQVLAPHMAMAQPQP
QPHVLAAQHGVQPALTPQPNQQLVQKQIPGVQPTPMGMKPQQLVMQQQQQQLANSFFPDT
DLDKFAAEDIMDPIAKAKMVALKGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGATAAAE
MQNHVPAGSGQERSGSDPSQTRPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLE
EQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHT
NLMAEYRNKQQQHQQSSAVMALSPSQSPRLMAKLPGQLLSAHGVQPQLPQQTGAMVGAQG
LGQQPNQLAGQAGNVRLPQGGVSMAVQQGLSFMGQQQLGNAAVPGTSNSFFPGNPALRGL
AADSRLMQERQLQRMQLAQKLQQQSMLGQVSLQQQQSMLGQVSLQQQQQQSMLGQVSLQQ
QQQSMLGQQQQSMLGQVSQQQQQQQSMLGQVSQQQQQQQSMLGQVSQSQQQQQSMLGQVS
QQQQQSMLGQVSQPPTPQQGSGGQPMVPKQQGILVQPLSPQPQPGMMGHSQVSMLQHQGV
AGHQTPPRQVLLAPHQQRVLGSPQLVQQTHGLMGHRLILSPAQQQQGAQPAPQGTAAKEQ
QGGAESAVLPPEGAEGRGQHPVQLSAAVGGPGSQDLGGQPHMGTQEQPGIQNLNPLALPS
QEQLAPLGGEQQPQKHQPELGQQQPRSLPSPQQTMASSLQRMQGGLQQGNLLHPPLQNCA
GLAQLGGTMRPEQPHSDPAQGPRLLAPPSSGAEPQQQPGSMTSQGQSIMVQLPPPQRIVG
QPPAQSLDQQAKGLAGQRLPSPAGQHKAGLVGQPQQSMLVPQVSHAQSILSQVSAPVMGQ
IRAQLQGVISKNPQLRHLTPQQQQQLQAFLVQRHQQTLLQQSQALRQASPFPGQAQASVE
QGPPPPSALQASMVRQQLRQPGTVFQVRPAGPSVAAEQMQPGFVMEQASAGQQRVPLSAP
QQPLAELVHTALAGRSPQQGVLRLSAPPAAAPVQPPMSMVSLGSVQQHPRPSREQSPQEP
KEASPPTLVRPPSVAQSPGAQPEHRLTPTQNSLLAEPVPAVPKPPPSQTGEESFARTPGH
WEPAAQGPHSSPSMEPTDGSRKPPAGSQVNGQGVERPGPQASPLPAQAPGVCIKQEPKEE
TAQCVLGGGQAVKREANGDPAPAPANNLLMGSQLLAGARSEAGHLLLQKLLRAKNVQLAS
QRSAEGLRAEVNGHSEGKLSGLEQRLQAAPPGREDPSASKKPPAPKPKRAQKSGERVAAS
RKKLRKEDGLKSSEALMKQLKQEFSLLPLVEPTITANFSLFAPFGSSPINGKNQLKGAFG
SAVLDSVPDYYTQLLTKNNLSNPPTPPSSLPPXPPPSVQQKMVNGVTSSEELAEQPKEPD
QAREAEGRKDAPAVEVKSLDLLAALPTPPHNQTEDVRMESDEESDSPDSIVPASSPESVL
GEEPPRFPLLAEVKPELPERVLSPVIPIIPRASIPVFPDPRPPEEHGGKVALAQGVAWEK
GKGSEVSVMLTVSATAAKNLNGVMVAVAELLRVKIPSSYEVLFPESPVRGSGPEAKKVET
DGAGGLGGKARAALAGKAPDAGTEWLKQFDAMLPGYSLKNELDILTLLKQESPGLEKAVQ
HCYVNNVSNLDVRQLSILPQEPSPPLSPLVPSPASPADGDRIPEAPPEVAPAPPSPPALS
PPSKEEAARSPPKLKQRSRPPEEGEEPRPRLKKWKGVRWKRLRFLITIQKGGAKQDGEEE
ISEFIEKLGTTLRPEKVPRDLRKCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSSE
VYETQGGALINVEGALHRGLLTKCSLCQKTGATNSCNRIRCPSVYHFACAIRAKCMFFKD
KTMLCPLHKLKGPCDQELSTFTVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLLFHAI
GQLLPHQMGDFHSVTALYPVGFEATRIYWSLRTNNRRCCYRCTICENNGRPEFVVQVIEQ
GLEDLVFTDSSPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESL
PGVESCQNYLFRYGRHPLMELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKAYQSTF
TGETNTPYSKQFVHSKSSQYRRLKTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIG
TIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTF
DKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
NT seq 13650 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggagcccgaggagctgggcccagccaccccgatggaggtgtatgggacgggc
gggaagctgctggagcgtggggaggaagtgggccccgagccccccatcctgcggccccgt
cccaccctcatcaagtcagacatcgtcaacgagatctccaacctgagccagggcgacacc
aggagcagcttccccggctcggagcccctgctgggctctccggaccccgagggcgggggc
tcgctctccatggagttgggcatgacctccactgacagcctgcagaaggacgacgccggc
tccctgccccactgcaccgactcgctggccgagacggacgactcgctgctcttcgagcca
ggcgctggggccaagggcgagggggagaaggggcgtcggcgcagctcgccggggcgctcc
cgcatcaaacagggtcgcagcagcagcttcccggggaggaggcgcccccgaggcgggacc
caggggggccggggccggggccgagctcggctgaagtcgaccacctcgtccattgagacc
ctcgcgctagcagatatcgacagctcccccagcaaggaggatgacgaggaggaggatgac
accatgcagaacaccgtggtgcttttctccaacacggacaagttcgtcctcatgcaggac
atgtgcgtggtgtgcggcagcttcgggcgcggggcggaggggcacttgctggcctgttcc
cagtgctcccagtgctaccacccctactgcgtcaacagcaagatcaccaaggtgatgctg
ctgaagggctggcgctgcgtggagtgcatcgtctgcgaggtgtgcggaaaggcctcggac
ccctcgcgcctgttgctttgcgacgactgcgacatcagctaccacacctactgcttggac
ccgccgctgcacaccgtgcccaagggcggctggaagtgcaagtggtgcgtgtgctgcgtg
cagtgcggggcgggttcccctggattccactgtgagtggcagaacaactacacgcactgc
gccccctgcgccagccttgtcacctgccccgtctgccgggtgaagtacgtggaggacgac
ctgctcatccagtgcaggcactgcgaccggtggctccatgctgtgtgcaacaatctcttc
acggaggaggaggtggaacaggcagcagacgagggcttcgactgcagctcctgccagccc
tacgtggtcaagccagtcgttccagtcgcccccccagagattatcccagtgaagatcaag
gagccggagccccagtatttccgcttcgaaggcgtgtggctgacggagacgggcatggcc
gtgctgcgcaacctgtccatgtcccccctgcacaagcgcaggcagcgcaagacccgtctc
ggcaccctgaatggggaggggggcctggaggggggtgaccccctgggcacggacgagaag
aaggacggggatctggatggggacgacctgctgaagggtgaagtgggcgtggagcacatg
gagtgtgagatcaagctggaagctgcggccagccccgaccgggacggaggggccgacgtg
gactcggggaaggggctggaggattcggaggagtgcaagaagaggaagcggaagccctac
cgcccagggatcggtgggttcatggtgcggcagcggaagtcccatacgcggctgaagaag
ggctcggcagcactggtggaggcatgtcgcgaggtgctgagcgccgaggggcacccggag
gacggggcgccggcggagatcccagcggagggcgctgcggagcagggcgccacggagggg
gacgagaagaagaaacgccgaggcaggaagaagagcaagttggaggatatgttccctgcc
tacctccaggaagcgttcttcgggaaggcgctcatggacctgagccgtaaggccctgctg
gccgcagggggtgtgggggatggagctgcctgccccccctttggccagggtgctcccaga
cccagggtggaccctggggtgcccggaacactccagagggtgcctggagatgggaaggag
acccctgcccatctgaaaggggacgacagcatggacagcagcgccctggtggcccaagag
gaggacccgaaaggggcggaagtgaaggctgaggacccaggggcagaggagccgaaaggt
tctccggatcctggggacagcgagaagccggcgacgcccggcgagggtgccctgagctcc
gaccttgacaagatccccacagaagaattgcccaagatggagagcaaagacatccagcag
ctcttcaaggatgtgctgggctctgccgagcgggagcagcaactgaactgcgtggcggca
gggatggaggccggcatgggagggcgagaccccaaccgagcgcagctctcccagaggccc
ttcctgcaagggagtgtttctctgggctcgctctcctccactgtccccatggagtcctac
tcaggagtctgccagtccccgttcctcgataacagggagagaagcggcttcttcagccca
gaccactgcgagcccgagagcccctgggccagcagctcggctgccaccaccccctccacg
cccaccaccccaaccacggagggtgagggggatgggctctcctacaaccagcggagccta
cagcgctgggagaaggacgaggagctgggcgaactgtccaccatctcgcccgtcctctat
gccaacatgaacttccccagcctcaagcaggattacccagactggtccagccgctgcaaa
cagatcatgaagctctggagaaaggtcccagccccggacaaagccccctacttgcaaaag
gccaaagataaccgggcggctcatcgcatcaacaaggtgcagaagcaggccgagagtcag
atcaacaagcagaccaaaggggaggtgctgcgcaagcctgagagaccctcactgcacctg
aggatcccgccccagcagggggcgctgccgggtgctgcggggcagcccgtctacatcaac
agcccggtggccctgcccggctccgcagacgggttcctgaagtcccctgctggcgccgaa
gctgcggctgagtccagcgaggtcttcctcaagcttccttcccagtccccagcccaagtg
ccttcgcacgacccctacagctacccgctggagccccgcttcccctcgcccctgggtcag
agccccacagccggagctgccttccagcccttccccacacaacagcagcagctcctgccc
actccccggccggccctgggcccccagcctccggagttccaccccacctcccccgggacg
ccccggcaccagccctccaccccagaccccttcctgaaaccacgctgcctcagtggctct
ctggacaacctgtcggtgccagggagccccggggccaggccccccgagcccctgctctcg
ccccctcccttcggggagcagaagaggagcctggaggctggggggctgcaggtgaagaag
gaggaagggggcccgggagtgtgttctcctggctacatggccgccatgggctacgccgac
tccccgtcccacctctcctccgccgagctgaaggcagccgacgtgttcaaagcccccctg
accccacgggtctctcaggtagagccacagagcccagggctggcgcatccccacccccag
gctctggccccctcacctcccagccaccccgacctctacaggcagtcgccctccgtgtcc
tgctactcggacccctatgcccagcctcccctgacgccccggccacagccccccgacagc
tgctgcgccctgccccccaggtccttgccttccgaccccttctcccgcgtccccgccagc
ccgcagtcccagtctagctcccagtcccctcttaccccccggccgctctccaatgaggct
tgctgccagtcacccgtcacccctcgcttccagtcacccgacccctactccagacccccc
tcgcgcccccagtcccgggacccttttgcccccctgcacaagcccccacggccccaaatg
cccgactccggcttcaaatcgatcccaatctcccacaatcccccagctggtggtggcttc
cctccggcccagcccagtgaccctcactccaaggggccggggagccagcagccccccttc
gcccgctcccctggagccagcgtcttcgctggcgcccaggcccagatgcggttcaccttc
ccctcagctgtctcagagcccctcaagggttccccctcccaccaaccccatgggatgaac
agccattttgcctctagccagcccatgggcaagccccaaagcgccaactatgcctcctcg
cccggcttccaccaggccggtagccccctggggcctggcaactgccctgctgagacctac
accctctctcccctgcggcccccctcggtgctgccgcagcagcccccccacccccagcag
cagcaggacggctccctgacctacctgccccgagccgggatggcgccgccagctgacaag
cgggacgaggtggtgtcggggatctctgctctccccagccgggagctgcccgaactgcca
gtcagccaggagggcgccgtcagcagcatcagccagtcggagctggagaagcagagacag
cgccagagactccgcgagctcctcatccgccagcaaatccagaggaacaatctgcggcag
gagaaggagagcgcggccgccgccaccagctcctcccaggcagcgtggagcgccgaagcc
agcagccaggccttcgagcagctccggggcctggcaccctaccagccagcacaggacaag
agcgcccttgggaatctgcccgcagcccccggcagcagcaaactctccgggccagccatg
gtgcccgcggccttcgcaccggacgaacggctttcccgcccgcctcccgctgccacgccc
tctgccatggacctcaatggcaggccgtcggtgggagccccccagaccttcttcccacgc
ggcatgttccaggggccctccccacagcagcagcagatgtggcagcagcagcaggcggcg
gccgtgcggctccccggccccgcccgcttccagcagccgcctggccatgagctcagccgg
ccggcgctggggggcctggctgggcgcatggcgggccctgccgagcagatcccgtcctcg
cccggcgccgtgggggcccaattcattgagctgcggcacaacgcccagaagggggcagcc
gggggcatgggctccccctttgcccagcagggccccccagccagaccacgcttcttcttg
cccggcgacgagagctccagccaggccctgcgtgcctccgtcatgcctctgccagcccca
gtcctgcagccccagaagctgccggcccctctgccgccctccgctacttccccgcagggg
gctgagcggagccaccagcctcctcccaaaagcggccctccggtgcccccgcctcccagt
ggcctggaactgcagcatggcccaccccgccctctgtcatcctccggctccggcctgcgt
cccgacggccccaaggacagccccgccatggagcccccactggctccggtcccggctcca
gctcccagcaagagccacttggcgctggagggtgggcggctcccgtgcgaggtgccggtg
gagcctgacctggacgacgacttcgactcccacaaggacctggaggacgacgacctggcc
aacctgagcctggacccggacgtggccaagggggacgacgacctgggcaacctggacaac
ctggagaccaacgacccccacctggacgacctgctgaacggcgatgagttcgacctgctg
gcctacaccgaccccgagctggacacaggcgacaagaaggacatcttcaacgagcacctg
cgcctagtggagtcggccaacgagaaggccgagcgcgaggccctgctcaagagggagccg
gctgggccctgccccaagggccccggggagcccaaggagctggcaccccccagggagggg
ctgctgcccgccccctgcccctccagcacggcaccggctccccacccaaccttcaaggcc
caggccagcatcctggaagccaagccggcctccctgccgtccagcgtccagcccaagctg
gaggaaggctgcctgaagacatccccctgtcagttcaacactggcgcctctgaccgcctc
ccggtccccgtcaagtcagaggccctccagggggccgagaaaatggctgcctccctaggc
ctgaccctcaagtctggccagaacctgctgagtgccggagcggggcccgtgcggctcggc
acagcccccttccctaacaacagccaagctgccacctctggctcagacaagggcccctac
gccgccccgggccgcgggctggcacccggccagagccctgccctgctggagctgggtgga
ggggccttgggcctggccaacgcccagcactcgcaggctgacgacctggagaagatggag
agctccctggtggccagcgagctgcccctgctcatcgaggacctgctggagcacgagaag
aaggagctgcagaagaagcagcagatgtcggcccacctgccggggggtgcccagcacctc
cagactgtgcagcaacagcagcagcactccgtactggctcaccctgcagggccggcccag
cccccggacgggcaggctccccgcctggtggggccccagcaacagctgcagctgggcctc
atcgccaggcagcagaacctggtgcccacccaacagctaatgacgcagcagcagcgggtg
gtgggaccccagcagggccaggtgctggccccacacatggcgatggcgcagccccagcct
cagccccacgtccttgcggcccagcacggcgtccagccggcgctgaccccacagccgaac
cagcagctggtgcagaagcagatacctggggtgcagccgacccccatgggcatgaaaccc
cagcagctcgtcatgcagcagcaacagcagcaattggccaacagcttcttccccgacaca
gacctggataagtttgcggccgaggacatcatggaccccatcgccaaggcgaagatggtg
gcactgaagggcatcaagaaggtgatggctcagggaagcattggggtggcccctggaatg
aacaggcaacaggtgtccctgctggctcagcggctctcgggggccacggccgcggccgaa
atgcagaaccacgtcccagctgggagcggacaggagcgaagtggcagcgacccatctcag
acccgccccaacccacccaccttcgctcagggcgtcatcaacgaggccgaccagcggcag
tacgaggagtggctcttccacacccagcagctcctgcagatgcagctgaaggtgctggag
gagcagatcggcgtgcaccgcaagtcccgcaaggccctgtgcgccaagcagcgcacggcc
aagaaggccggtcgcgagttccccgaggccgacgccgagaagctcaagctggtgacggag
cagcagagcaagatccagaagcagctggaccaggttcggaagcagcagaaggagcacacc
aacctgatggccgaataccgcaacaagcagcagcagcaccagcagagctccgccgttatg
gccctgagcccctcgcagagcccccggctcatggccaagctcccgggccagctgctctcc
gcccatggcgtccagccacagctcccccagcaaactggggccatggtgggggcgcaaggc
ctgggccagcagcccaaccagctggcagggcaagcaggcaacgtgcgcttgccccagggc
ggcgtctccatggcggtgcagcagggcctgtccttcatgggccagcagcagctgggaaac
gcagccgtccccggcacgtccaacagcttcttccctgggaatcccgcgctccgggggctg
gccgccgacagccggctgatgcaggagaggcagttgcagaggatgcagctggctcagaaa
ctgcagcagcaaagcatgctgggacaggtgtcattgcagcagcagcaaagcatgctggga
caggtgtcattgcagcagcagcagcagcaaagcatgctgggacaggtgtcattgcaacag
cagcagcaaagcatgctgggacagcagcagcaaagcatgctgggacaggtgtcgcagcag
caacagcagcagcaaagcatgctgggacaggtgtcgcagcagcaacagcagcagcaaagc
atgctgggacaggtgtcgcagtcgcaacagcagcagcaaagcatgctgggacaggtgtcg
caacagcagcagcaaagcatgctgggacaggtgtcgcagccccctactccccagcagggc
agtggggggcagcccatggttccgaagcagcaggggatcctggtccagccgctctcgcct
cagccgcagccggggatgatggggcactcccaggtgtccatgctgcagcatcagggcgtc
gcgggccaccagacccccccgaggcaggtgctgttagccccccaccagcagagggtgctg
ggctcgccgcagctggtgcagcaaactcacggcctcatgggccaccggctgattttatcg
ccagcgcagcagcagcagggagctcagccagccccgcagggcacggccgccaaggagcag
cagggaggggcagagagcgctgtgctgcccccagagggtgccgagggcagggggcagcat
ccggttcagctgtcggccgctgtgggtgggccgggcagccaggacctcggggggcagccg
cacatgggcactcaggagcagccgggcattcagaacctcaatcccctggcactgcccagc
caggagcagctggcgcccctgggcggagagcagcagccgcagaaacaccagcccgagctg
gggcagcagcagccccgctcactgccctccccgcagcagaccatggcgagctccctgcag
cgaatgcaggggggcctgcagcaaggcaacctgcttcatccgccgctgcagaactgcgcg
gggctggcgcagctggggggcaccatgaggccagagcagccgcactcggaccctgcccag
gggcctcgcttgctggccccgccgagctcaggggcagaaccccaacagcagcccgggagc
atgacgagccaggggcaaagcatcatggtccagctgccgccgccgcaaaggattgtgggc
cagccgccagcacaaagcttagaccagcaagccaaagggctggcgggccagcggctgccg
agcccggcggggcagcacaaggccgggctggtggggcagccgcagcagagcatgctggtc
ccgcaggtgtcccatgcacagagcatcctgagccaggtgtccgctcccgtgatgggccaa
atccgagcgcagctgcaaggcgtcatctccaaaaacccgcagctgcggcacctcaccccg
cagcagcagcagcagctccaggccttcctggtgcagcgccaccagcagaccctgctgcag
cagagccaggcgctgagacaggccagccccttcccggggcaggcccaggcatccgtcgag
caggggccgcccccgccctcagccctgcaggcctccatggtgcgccagcaactgaggcag
ccggggacagtgttccaggttcggccagccggcccctccgttgctgccgagcagatgcag
ccagggtttgtcatggagcaggcgtccgccggccagcagagagtgccgctgagcgccccc
cagcagccgctggcggagctggtgcacacggcgctggcgggacggagtccccagcagggg
gtgctcagactctctgccccaccagcagctgccccggtccagccgcccatgagcatggtg
agcctgggctctgtgcagcagcacccccgccccagccgggaacagagcccccaagagcca
aaggaagcctccccgcccaccctggtcaggccgcccagtgtggcacagagccccggggca
cagcccgagcacaggctgacgcccacccagaacagcctcctggcggagccggtgcctgcg
gtcccaaagcctccccccagccaaacaggggaggagtcctttgccaggacccctggccac
tgggagccggcagcgcagggtccccactcctctcccagcatggagcccacggatggatcg
agaaagccaccagccgggagtcaagtcaacgggcagggggtagaaaggccaggcccacag
gcctctcccctgccagcccaggcccccggggtctgcatcaagcaggagcccaaggaggag
acggcgcagtgtgtgctgggcgggggccaggctgtgaaacgcgaggccaacggggatccg
gcgcccgccccggccaacaatctactgatgggcagccagctgctggcgggcgccaggtct
gaggccgggcacctgctgctgcagaagctgctgcgggccaagaacgtgcagctggcgtcg
cagcgctccgccgaggggctgcgcgccgaggtcaacgggcacagcgagggcaaactctcg
gggctggagcagaggctgcaggcggctccccctggccgagaggatccctccgccagcaag
aagcctccggccccgaagcccaaacgggcgcagaagagcggggagcgggtggccgcctcc
cgcaagaagctgcgcaaggaggatgggctcaaatccagcgaggccctaatgaagcagctg
aagcaggagttctccctgctgcccctggtggaacccaccatcacggccaacttcagcctc
ttcgcgcccttcggcagcagccccatcaacggcaagaaccagctcaagggggcgtttggc
agcgccgtgctggacagcgtccctgactactacacccagctgctcaccaagaacaacctg
agcaacccgcccaccccgccctcctcgctgccccccnacccacccccctccgtgcagcag
aagatggtgaacggcgtcacctcctcggaggagctggccgagcagcccaaggagccggac
caggcccgggaagccgaaggccggaaggacgcgccagccgtggaggtgaagagcctggac
ctgctggcggccctgcccacgcccccgcacaaccagaccgaggacgtgaggatggagagc
gatgaggagagcgactcccccgacagcatcgttcccgcctcgtccccagagagcgtcctg
ggcgaggagccgccccgcttccccctgctggccgaggtgaagccggagctgccggagcgg
gtgctgtcgcccgtcatccccatcatccccagggccagcatcccagtgttccctgaccca
aggccccccgaggagcacggcgggaaggtggccctggcgcagggcgtcgcatgggagaag
gggaaaggcagcgaagtctccgtcatgctgaccgtctcggccacagctgctaagaacctg
aacggcgtcatggtggccgtggccgagctgctccgcgtgaagatccccagctcctacgag
gtgctgttccccgagagcccggtgcggggctccggccctgaggccaagaaggtggagacg
gacggggctggtgggctcggcggcaaggccagggcggcactggccgggaaagcccccgat
gctggcaccgagtggctgaaacagtttgatgccatgctgccggggtacagcctcaagaac
gagctggacatcctgacgctgctcaaacaggagagcccgggcctggagaaggccgtgcag
cactgctacgtgaacaacgtctccaacctggacgtgcgtcagctctccatcctgccccag
gagccgtccccgcccctgtcgccccttgtcccctcccctgccagccccgccgacggggac
aggatcccagaggcgccccctgaggtggcccccgcgcccccctccccgccagccctctcc
ccgccctccaaggaggaggcggcgcgctcgccgcccaagctcaagcagcgctcgcggccc
ccggaggagggagaggagccccggccccggctcaagaagtggaagggggtgcggtggaag
cggctccgcttcctcatcaccatccagaagggcggcgccaagcaggacggcgaggaggag
atctccgagttcatcgagaagctgggcaccaccctgcggcccgagaaggtgccccgggac
ctgcgcaagtgctgcttctgtcacgaggagggggatggtgccaccgatgggcccgcccgc
ctcctcaaccttgacctggacctctgggtgcacctgaactgcgccctgtggtccagtgag
gtgtacgagacgcagggcggggcgctgatcaacgtggagggggcactgcaccgtgggctg
ctcaccaagtgctccctgtgccagaagacgggcgccaccaacagctgcaaccgcatccgc
tgccccagcgtctaccacttcgcctgcgccatccgggccaagtgcatgttcttcaaggac
aagaccatgctgtgcccgctgcacaagctcaaaggcccctgcgaccaggagctcagcacc
ttcaccgtcttccggcgcgtctacatcgagcgcgacgaggtcaagcagatcgccagcatc
atccagcgcggcgagcgcctccacatgttccgcgtgggcggcctgctcttccatgccatc
ggccagctgctgccccaccagatgggcgacttccacagcgtcacagccctctaccccgtg
ggcttcgaggccacccgcatctactggagcctgcgcaccaacaaccgccgctgctgctac
cgctgcaccatctgcgagaacaacgggcgccccgagttcgtggtgcaggtcatcgagcag
ggcctggaggacctggtcttcaccgactcctcgccacaggccgtctggaaccgcatcatc
gagccggtggcggccatgaggaaggaggcagacatgctgcggctcttccccgagtacctg
aagggcgaggagctctttggcctcacggtgcacgcggtgctgcgcatcgccgagtcccta
cctggcgtggagagctgccagaactacctattccgctatgggcgccacccgctgatggag
ctgccgctcatgatcaaccccaccggctgcgcccgctccgagcccaagatcctcacccac
tacaaacggccccacaccctgaacagcaccagcatgtccaaggcctaccagagcaccttc
acgggtgagaccaacacgccctacagcaagcagttcgtgcactccaagtcctcgcagtac
cgccgcctcaagaccgagtggaagaacaacgtgtacctggcgcgctcccgcatccagggg
ctggggctctacgctgccaaggacctggagaagcacaccatggtcatcgagtacatcggc
accatcatccgcaacgaggtggccaaccggcgcgagaagatctacgaggagcagaaccga
ggaatctacatgttccgcatcaacaatgaacacgtcatcgacgccacgctgacggggggc
ccagccaggtacattaaccactcgtgcgccccgaactgtgtggctgaggtcgtgaccttc
gacaaggaagataagattatcatcatctccagccgccggattcccaaaggggaggagctg
acctacgactaccagtttgacttcgaagacgatcagcataaaatcccctgccactgcgga
gcctggaactgcaggaaatggatgaactag

DBGET integrated database retrieval system