KEGG   Chrysemys picta (western painted turtle): 101934647Help
Entry
101934647         CDS       T04662                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cpic03036]
    101934647 (HDAC10)
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101934647 (HDAC10)
Chromosome and associated proteins [BR:cpic03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101934647 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl Fz
Motif
Other DBs
NCBI-GeneID: 101934647
NCBI-ProteinID: XP_008171087
LinkDB All DBs
Position
2
AA seq 768 aa AA seqDB search
MCVAVRDSCAPLLLCHGLSWPDSLDCDRFPADEDMCLASLSKEYKHIHKELPKPICQTCP
AVEEFFTQKRVLDVFCANNFAMASGTALIYDDEMTSCKLLWDDPECDIEVPERLLSSYEQ
LKHYHLVERCIHVPVREGTEEEIMLVHSSEYLEVVKSTQTMNEEELRRVSENYDAVYFHP
NTYRCAKLAVGATLQLVDSVISGKVHNGMALVRPPGHHSQRNAANGFCVFNNVAIAAQYA
KRRYGLQRILIVDWDVHHGQGIQYVFEEDPSVLYYSWHRYEHQQFWPLLRESDYDAVGQG
KGKGFNLNVPWNKVGMGNSDYLAAFFHVLLPVAFEFVPELILVSSGYDSGIGDPEGQMNA
TPECFAHLTHFLMQLANGRVCAVLEGGYHLKSLSESVCMTVKTLLRDPLPQISGEMAPCL
SAVESIQNVRAAHKPYWKCLMYEEATPLHNLSTKSQQMMEAELIQTSTHPTAKQAVGTTN
SDEAIKTDRFLESHMKKILFPVPPVKTAAAIVSKADAHLLPISVQVEMEMNAQELKTLVS
AFDAELVKEEKALLSLQNVLAVLDKILKKKVCNGIAESSVASVSTTFALKHCFDFGLQRV
LCIVVGDMDLELDLDDGKILLMNICQKQQTEKTNSKYHISLNWKEDAGRNNFFCAVLGFI
LPVAYSYQPDLMIIVIGPNRSLGVNAISLLTCLLQGLAESRILVVIQDTEIKLVQSVAKA
LSGVSTPDFGAYAPASQENVFEIKQLKDQLQQEWKMLRCSVKDWISGS
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtcgctgttcgtgacagctgtgctcctctgctcctctgccatggactgtcttgg
cctgacagtttggactgtgatcgtttccctgctgatgaggacatgtgtctagcatctctt
agcaaagaatacaaacatattcataaagaattgccaaagcctatatgccagacctgccca
gcagtggaggaattctttacacagaaaagagtactagatgttttctgtgccaacaacttt
gcaatggcttcaggaacagctttgatttacgatgatgaaatgacaagttgcaaactactt
tgggatgaccctgagtgtgatattgaagtgccggaaagattgttatcctcctatgagcaa
cttaaacattatcatcttgtggaaagatgtatccatgtacctgtcagggaaggaaccgaa
gaagaaattatgttggttcacagttcagaatacttggaagttgtaaagagcacccagaca
atgaatgaagaagaactccgaagagtctcagaaaattatgatgctgtttactttcatccg
aatacttaccgctgtgctaagctagcagtaggagcaactttgcaactggtggactctgtg
atatcaggaaaagtgcacaatggaatggcattagtaaggcctccaggtcatcacagccag
cgaaatgcagccaatggattctgtgtgttcaataatgttgctattgcagctcaatatgcc
aaaagacgatatggtcttcagagaattctcattgttgactgggatgtgcaccatgggcaa
ggaattcaatatgtatttgaagaggatcccagtgttctctattactcctggcatcgctat
gaacatcagcaattctggcccttgctcagagaatctgattatgatgctgttggtcaggga
aaaggaaagggattcaatttaaatgtaccttggaataaggttggaatggggaattccgat
tatctagctgcatttttccatgtgttgcttccagttgcttttgagtttgttccagaactt
attctggtctcttctggatatgattcaggaattggtgaccctgagggtcagatgaatgct
actccggagtgttttgctcaccttacacatttcctaatgcagttagctaatggaagggtg
tgtgcagttctagagggtggataccatttgaaatcattgtctgaatcagtctgcatgact
gtaaaaactttgcttagagaccctctcccccagatctctggagaaatggcaccatgctta
agtgctgttgagtctatacaaaatgtgagagctgcacataaaccatactggaaatgtttg
atgtatgaagaagcaactcctttacacaatcttagcaccaaatcacaacagatgatggag
gctgagctaattcaaactagtacacatcccacagcaaagcaagcggttgggacaactaac
agtgatgaagccatcaaaacagaccggtttttggaatcacacatgaaaaaaattctcttt
ccagtgcctcctgttaaaacagcagcagcaattgtctctaaagctgatgcacatttgcta
ccaatatctgttcaagtggagatggaaatgaatgcacaagaactgaaaactctcgtcagt
gcatttgatgcggaacttgtgaaggaagagaaagctttactctctcttcagaatgtgctg
gctgtcctagataaaatactaaagaaaaaggtgtgcaatggaattgcagaatcatctgtg
gcttctgtttctactacctttgcactaaagcactgctttgattttggattacaaagagtg
ctctgcatagttgttggagacatggatcttgaactcgacttagatgacggaaaaatactt
ttgatgaacatttgccagaaacaacaaactgaaaagactaactccaaataccatatttct
ctgaactggaaagaggatgctggaagaaacaatttcttttgtgctgtacttggattcatt
cttcctgtagcgtatagctatcaacctgacttaatgataatagtcattggaccaaacagg
agcctcggtgtaaatgcgatttctctgcttacttgtttactgcaaggattagctgagtct
cgaattcttgtggtaatacaggacacagaaataaaactagtgcaaagtgtggccaaagcc
ttatcgggtgtttctacacctgactttggagcctacgcacctgcttcccaagaaaatgta
tttgaaataaaacaattaaaagaccaacttcaacaggaatggaaaatgcttcgatgttca
gtaaaggactggatttctggaagctga

DBGET integrated database retrieval system