KEGG   Chrysemys picta (western painted turtle): 101935558
Entry
101935558         CDS       T04662                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04010  MAPK signaling pathway
cpic04020  Calcium signaling pathway
cpic04144  Endocytosis
cpic04510  Focal adhesion
cpic04540  Gap junction
cpic04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101935558 (PDGFRA)
   04020 Calcium signaling pathway
    101935558 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101935558 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101935558 (PDGFRA)
   04540 Gap junction
    101935558 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101935558 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101935558 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cpic04090]
    101935558 (PDGFRA)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101935558 (PDGFRA)
Protein kinases [BR:cpic01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101935558 (PDGFRA)
CD molecules [BR:cpic04090]
 Proteins
  101935558 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set
Other DBs
NCBI-GeneID: 101935558
NCBI-ProteinID: XP_005299161
LinkDB
Position
4
AA seq 1096 aa
MELLMVLSAVMGTSPRTFLLLGCLLTGPWLTFCQLPLPTVLPNRDEMVVQLNASFTLKCS
GDSEVTWQYPMAEGSHRIDIRNEENNSGLFVTLLEVGNASAAHTGLYTCYYNHTQEEDGE
VEGKDIYIYVPDPDIPFVPLLPEDQFILVEDGDSTIIPCRTSDPNAQVALVNSEAKVVYA
YYDSKQGFLGNFPAGSYTCQTTVKEVEFKSDQFFIYILKATSELPVEIEALKTVYKTGET
IVVTCVVFDNEVVNLQWNYPGKVKEKGVIKVDDIKVPSQKLVYTLTIPEASVKDTGDYEC
TARHATKEVKENKRVVITVHDKGFIHLDPQFSPLEAVNLHEVKNFVVDVQAYPAPKMFWL
KDNVTLTENLTEIVTSANKINETRVQSILKLIRAKEEDSGDYTLVAENGEETKSYTFSLL
IQVSASILKLVDHHGSGGGQTVQCLAKGTPFPDVEWLICKDIKKCSNDTSWILLTNNISN
IHMEAYRVDKDQVKSQVTFQKVEETLVVRCMARNTLGAVTRELKLVAPTLRSELTVAAAV
LVLIVIVIISLIVLVIIWKQKPKYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRD
GLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHL
GPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSQHPEKPKKDLDIFGMN
PADESTRSYVILSFENNGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSMYDRPASYKKK
SVSEPEVKNLLSDDNSDSLSLLDLLSFMYQVARGMEFLASKNCVHRDLAARNVLLAQGKI
VKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSL
GGTPYPGMMVDSSFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVE
NLLPGEYKKSYERIHLDFLKSDHPAVTRMRVDCDNTYIGVTYKNEDKLKDRESGFDEQRL
SADSGYIIPLPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMM
DDIGIDSSDLVEDSFL
NT seq 3291 nt   +upstreamnt  +downstreamnt
atggaacttctcatggtgttgtccgcagtgatgggtacttccccaaggacattcctgctc
ctgggatgtctcctgacaggaccatggctaactttctgccagcttccattgccgactgtt
cttccgaatagagatgaaatggtcgtgcaactgaatgcctcgtttactctgaaatgctct
ggagacagcgaagtgacctggcaatacccaatggctgaaggaagccacagaatagacatt
agaaatgaagagaacaacagtggtctctttgtgactttgctggaagtggggaatgcctca
gctgctcataccggattatacacttgttactacaatcatactcaagaggaggacggggag
gtggaggggaaggatatctacatctatgtgcctgatccagatatacccttcgttcctcta
ctaccagaggatcaattcatcctagtagaagatggtgattccaccattatcccttgtcgt
acaagtgatcctaatgctcaagtagctttagttaacagtgaagccaaggtcgtatatgcc
tattatgacagcaaacaaggcttcctaggaaattttcctgcaggctcatacacatgccaa
acaactgttaaagaagtggagttcaagtcagatcagtttttcatctacattttgaaagct
acttcagagctgccagttgagattgaggcccttaaaactgtatataaaacaggcgaaacg
attgttgtaacttgtgtggtctttgacaacgaggtggttaatttacagtggaattatcca
gggaaagtgaaagaaaaaggtgtgataaaagttgatgacattaaagttccctcccagaag
ctggtttacactttgaccattcctgaggcttcagtgaaagataccggggattatgaatgt
acggcccgacatgcaaccaaggaggttaaagaaaataagagagtagtcattacagttcat
gataaaggattcattcatctggacccccaatttagccctttggaagctgtcaatttacat
gaggtcaaaaattttgtagtggatgtgcaggcgtacccagctccaaaaatgttctggctg
aaggacaatgtgactctgactgagaatcttacagagattgttaccagtgcaaacaagatc
aatgagacaagggtccaaagtatattaaaactgattcgggccaaggaagaagacagtgga
gattatactttggttgctgaaaatggagaagagactaaaagttatactttctcgttgcta
atacaagtttcagcttcaattctaaaactggtggatcaccacggctctggagggggacag
acggtccaatgcttggcaaaagggacgcctttccctgacgtggaatggctgatttgcaag
gacattaaaaaatgcagtaatgatacctcatggatacttctgactaacaacatctcaaat
atacacatggaggcttatcgggttgataaggaccaggtgaaaagccaggtgaccttccaa
aaggtagaagaaaccctggtagtacggtgcatggcgaggaacactcttggtgccgttact
cgggaactgaagcttgtggctcctacattgcgatcagaattaactgtggctgcagcagtc
ctagtgttaatagtgattgtgattatttcactgattgtcctggtcatcatatggaaacag
aaaccaaagtatgagataagatggagagtaattgagtctatcagccctgatggccatgag
tacatttatgtggacccaatgcaactgccctatgactcaagatgggagtttcctagagat
ggattagtacttggtcgaatccttggttcgggcgcgtttgggaaagtagttgaaggaact
gcatatggattaagtcgctctcaaccagtgatgaaggtagctgtgaaaatgctgaaaccc
acagctagatccagtgaaaaacaggcactaatgtctgaactgaagataatgacacatctt
gggcctcatttgaacattgtgaatctcttaggagcttgtactaagtcaggtccaatttac
atcattactgaatactgcttttatggggatttggtaaactacctgcataaaaacagggat
aatttcctgagccaacatccagaaaagccaaagaaggacttggacatttttgggatgaac
ccagctgatgaaagcacaagaagttatgtcattttatcctttgaaaacaatggcgaatac
atggacatgaaacaagctgatacgactcagtatgtgccaatgctggaacggaaggagggt
tctaagtattcggatatccagagatcaatgtatgatcggcctgcttcatataagaaaaaa
tctgtgtcagaaccagaagtcaaaaacctgctttctgacgacaattctgacagcctcagt
ttgctggatttactaagcttcatgtaccaagttgcacgggggatggagttcttggcttct
aaaaattgtgtgcaccgtgacttggcagctcgtaatgtccttctggctcaaggaaaaatt
gtgaagatctgtgactttggtctggctagagacatcatgcatgattccaactatgtctcc
aaaggcagcacttttctcccagtgaaatggatggcacctgaaagcatttttgacaatctg
tacacaacattaagtgatgtctggtcttatggcattctgctgtgggagatattttctctt
ggtggcacaccataccctggcatgatggttgattcttctttctacaacaagataaaaagt
ggctaccgaatggcaaaacctgaccatgctaccagtgaagtgtatgagattatggtgaaa
tgttggaacagcgaaccggagaaaagaccttctttttaccatttgagtgaaattgtggag
aatctgttgcctggcgaatacaagaagagctatgaaaggattcatctggacttcctgaaa
agcgaccacccagcggtcacacgcatgagagtggactgtgacaacacctacatcggtgtc
acttataagaatgaagacaagctaaaggacagggagagtggatttgatgagcagaggttg
agcgctgatagtggctacatcatccccctgcccgacattgatcccgtctccgaagatgaa
cttggcaaaagaaacaggcacagttcccagacatctgaagaaagtgctattgagactggt
tcaagcagctctacctttatcaaacgagaggatgagaccattgaggacattgacatgatg
gatgacattggaatagattcctcagacctggttgaagacagctttctgtaa

DBGET integrated database retrieval system