KEGG   Chrysemys picta (western painted turtle): 101935728Help
Entry
101935728         CDS       T04662                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00010  Glycolysis / Gluconeogenesis
cpic00030  Pentose phosphate pathway
cpic00051  Fructose and mannose metabolism
cpic00052  Galactose metabolism
cpic01100  Metabolic pathways
cpic01200  Carbon metabolism
cpic01230  Biosynthesis of amino acids
cpic03018  RNA degradation
Module
cpic_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101935728 (PFKP)
   00030 Pentose phosphate pathway
    101935728 (PFKP)
   00051 Fructose and mannose metabolism
    101935728 (PFKP)
   00052 Galactose metabolism
    101935728 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101935728 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cpic01009]
    101935728 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cpic03019]
    101935728 (PFKP)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101935728 (PFKP)
Protein phosphatases and associated proteins [BR:cpic01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101935728 (PFKP)
Messenger RNA biogenesis [BR:cpic03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101935728 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK PP-binding_2
Motif
Other DBs
NCBI-GeneID: 101935728
NCBI-ProteinID: XP_008161155
LinkDB All DBs
Position
Un
AA seq 814 aa AA seqDB search
MNAAVRAVVRMGIYVEAKVYFIYEGYQGMVDGGDNIVEVSWESVSSILQVGGTVIGSARC
KEFRTREGRLKAAFNLIQRGITNLCVIGGDGSLTGANLFREEWSGLLEELAQSGKIEEEA
VKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFIPEYPPEEGWEDQMCVKLSENRARKKRLNIIIVAEGAIDS
HNKSITSEEVKDLVVQQLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATA
DTPACVVSLSGNQAVRLPLMECVQMTQEVQKAMDERKFCEAVRLRGRSFENNLNTYKLLS
HRKPDTELPKDHLSCSTNFNVAVLNVGAPAAGMNAAVRSAVRVGITEGHTMFAVTDGFEG
FANGQIKEISWGDVGGWTGQGGSLLGTKRTLPAKYLEKIADQMRTNNINALMVIGGFEAY
LGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDAYESCLQLAEA
RARFEEFCIPICVLPATISNNVPGTDLSIGADTALNAIVETCDRIKQSASGTKRRVFIIE
TMGGYCGYLANMGGLAAGADAAYIFEEKFDIRELQANVEHLTEKMKTSIQRGLVLRNENS
NENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAIQWISKKL
RETYRRDEGKVFANTEDSVCLLGMRRRNLLFQPVVELKDQADFVHRIPKEQWWLKLRPLM
KILAKYKTSYDVSDSGQLEHVARHSPKEADTGAI
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgcagtacgtgcggtagtgcgtatggggatctacgtagaagctaaagtgtat
tttatctatgagggttaccaaggtatggttgatggaggtgacaacattgttgaagtatca
tgggaaagtgtttcaagcatcttgcaagtgggagggacagttattggtagcgcacgctgc
aaagaatttcgtacccgggaaggccgtttgaaggcagctttcaacttgattcagcgtgga
atcactaacctttgtgtgattggtggtgatggtagtttaacaggtgctaatctctttcgt
gaagaatggagtggacttctagaggaactggcacaaagtggcaagattgaagaagaagct
gtgaagaaatatgcttacctcaacattgtggggatggttggatccatagataatgacttc
tgtggcacagatatgaccattggtactgactcagccttgcacagaatcattgaagttgtg
gatgccatcatgaccactgctcaaagccatcagaggacctttgtcctagaagttatggga
agacactgtgggtatctagctcttgttagtgcattagcttgtggtgcggattgggtattt
attccggaataccccccagaagaaggatgggaggatcagatgtgtgttaagctttctgag
aaccgtgcacgaaagaaaaggctgaatatcataattgtggcagaaggtgccattgattct
cacaacaaatctataacttcagaagaggttaaggatcttgtggttcagcagctgggattt
gacactcgtgtgactatcctcggtcatgttcaaagaggtggtactccttcagcttttgat
agaattttggcaagccgtatgggcgtggaagctgtcctggcccttctagaggctacagca
gatacccctgcttgtgttgtatccctgtctgggaaccaagctgtccgtctgcctttaatg
gagtgtgtgcagatgactcaagaagtacagaaagcaatggatgaaagaaagttttgtgag
gctgtgagacttcgtggaaggagctttgaaaacaaccttaacacctacaaattattgtct
cacagaaaaccagatacagaacttccaaaggaccatctctcatgtagtactaattttaat
gtggcagttttaaatgtaggtgcccctgcagctggtatgaatgctgctgtccgatctgca
gtaagagttggcataactgaaggtcacaccatgtttgctgtcactgatggatttgaaggc
tttgctaatggccagataaaggaaatcagctggggagatgttggaggttggactggccaa
ggagggtcgcttcttggcacaaaacgtaccctccctgcaaagtatttggagaagattgct
gaccagatgcgcactaataacatcaacgcccttatggttattggtggatttgaggcctac
ctgggacttttggaattatcagctgcccgtgagaaatatgacgagttctgtgttccaatg
gttatggttcctgcaactgtatccaacaatgtaccgggttcagatttcagcattggtgca
gatactgctctgaacactataactgatgcctatgaaagttgtctgcaattagctgaggca
cgtgctcgctttgaggagttttgtattcctatctgtgtgttgccagctactattagcaac
aatgtgccaggcaccgaccttagcattggtgctgacactgccctgaatgctattgtggag
acatgtgatcgcatcaaacagtcagccagtgggaccaagcgtcgtgtgttcatcattgag
acaatgggtggctactgtggttacctggccaatatggggggccttgctgcaggtgcggat
gctgcttatatctttgaagagaagtttgatattcgagaactccaggctaatgtggagcat
ttgaccgaaaagatgaaaaccagcatccagcgtggtctagtgctgaggaatgagaacagc
aatgagaattacacaactgactttatctaccagctatattctgaggaaggaaaaggcgtg
ttcgattgcagaaagaatgtattgggccacatgcagcagggtggagcaccttccccattt
gacaggaactttgggacaaaaatctctgcaaaagctatacagtggatctcaaagaaactg
agagaaacataccgaagagatgaaggaaaagtgtttgccaacaccgaagactcagtttgt
ttgctaggtatgcgcagacgcaatcttcttttccaacctgtggttgagcttaaggatcaa
gcagattttgtgcacagaattcctaaggaacagtggtggctgaaacttcgacctctgatg
aaaattctggccaaatacaagactagctatgatgtttcagattcaggtcaactagagcat
gtagctaggcacagcccaaaagaagcagatactggagctatctaa

DBGET integrated database retrieval system