KEGG   Chrysemys picta (western painted turtle): 101935922Help
Entry
101935922         CDS       T04662                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00250  Alanine, aspartate and glutamate metabolism
cpic00280  Valine, leucine and isoleucine degradation
cpic00410  beta-Alanine metabolism
cpic00640  Propanoate metabolism
cpic00650  Butanoate metabolism
cpic01100  Metabolic pathways
Module
cpic_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    101935922 (ABAT)
   00650 Butanoate metabolism
    101935922 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101935922 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    101935922 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101935922 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpic01007]
    101935922 (ABAT)
Enzymes [BR:cpic01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     101935922 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     101935922 (ABAT)
Amino acid related enzymes [BR:cpic01007]
 Aminotransferase (transaminase)
  Class III
   101935922 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2
Motif
Other DBs
NCBI-GeneID: 101935922
NCBI-ProteinID: XP_005295305
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MALMLLSRQPGVLLQRTSQLFACGHRLISQTAAKIDVDFDYDGPLMKTEVPGPKSRELMK
QLNGIQNAEAVHFFCNYQESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPSLMKLLQQPQ
NLSTFVNRPALGILPPENFAENLKESLLSVAPKGLQQIITMSCGSCSNENAFKAIFMWYR
NKERGNNNVTKEELETCMINQSPGCPDYSILSFMGGFHGRTMGCLATTHSKAIHKLDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKRIVTGIIIEPIQSEGG
DNHASDDFFRKLRDITRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVVTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLMLAEVINVIKREDLLNNATHAGKALLAGLL
DLQARYPHLISRARGRGTFCSFDTPDDTTRNKLIAIARNKGVVLGGCGDRSIRFRPTLIF
KDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccttgatgttgctcagtcgacagcctggagttctgttgcagagaacaagtcagcta
tttgcatgtgggcacagattgatcagtcaaactgcagctaaaattgatgtggactttgat
tatgatggaccgttaatgaagacagaagttcctgggcctaagtccagagagttaatgaaa
cagttaaatggaattcagaatgcagaagccgtgcactttttttgcaattatcaagagagc
cgagggaactaccttgtagacgtagatggcaaccgcatgctggatctctactctcagatt
tcatccatcccaataggttacagccatccatctctgatgaaacttctccagcagccacag
aacttgagtacatttgttaacagacctgctcttgggattttacctccagagaattttgct
gaaaacttaaaggaatctttgctttcggtggctcctaaaggcctgcaacagattatcacc
atgtcctgtggatcctgctctaatgaaaacgcctttaaagcaatattcatgtggtacagg
aacaaagaaaggggtaataataatgtcacaaaggaagaactggagacatgcatgattaac
cagtctccagggtgccctgactatagtattctgtcctttatgggtggattccatggaaga
accatgggttgcttagctacaactcactctaaagcaattcacaaattagacattccatca
tttgactggccgattgctccattcccaagactaaaataccccctggaagagtttgtgaaa
gagaatcaacaggaagaagcccgctgtttagaagaggtggaagatctgattgtaaagtac
aggaaaaagaagaggattgttactggaataatcattgaaccaattcagtcagaaggggga
gacaatcatgcttcagatgacttcttcaggaagctacgggacattaccagaaagcatggc
tgtgcatttctggtggacgaggtgcagacaggaggcggctgcactgggaagttttgggcc
catgaacactggggcctagatgacccagccgatgtggtaacatttagtaagaagatgatg
acaggaggattttttcacaaggaggagttcaggcccaatgctccatatcggatttttaac
acctggcttggagatccctccaagaacctcatgcttgctgaagtcattaacgttattaag
agggaagaccttctaaacaatgcaacccatgcagggaaagctctactagccgggctgttg
gacttacaggctcgttacccacatctcatcagcagagcgagaggacgagggacattctgt
tcgtttgatactccagatgatacaactaggaacaagctaattgcaatagccagaaacaaa
ggtgttgtgctgggaggctgtggcgacagatcgatccgtttccgcccaactctgatcttc
aaggatcaccatgcgcacctctttctgaacatcttcagtgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system