KEGG   Chrysemys picta (western painted turtle): 101936465Help
Entry
101936465         CDS       T04662                                 

Gene name
SI
Definition
(RefSeq) sucrase-isomaltase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00052  Galactose metabolism
cpic00500  Starch and sucrose metabolism
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101936465 (SI)
   00500 Starch and sucrose metabolism
    101936465 (SI)
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101936465 (SI)
    3.2.1.20  alpha-glucosidase
     101936465 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101936465
NCBI-ProteinID: XP_008163216
LinkDB All DBs
Position
Un
AA seq 2712 aa AA seqDB search
MGKKKFSGLEISLIVLFCLVVIVACILVGLLATGQSGLQDFSPDCPAVSFTERIDCIPDR
GATKSLCTLRGCCWSPQNDTSIPWCFFSKSHGYKVEGGVKQTNTGIAAKLTRLPSPSLFG
NDITTVQLTGEYQTTNRFRFKITDPNKKRFEVPHENVKAFDGPAASNLNYKVNIIQNPFG
ITVVRTSSSKTLFDTSIGPLQYADQYLQLSIKLPSSNIYGIGEHVHTQYRHDVNWRTWPI
FTRDAFPNGGTHNLYGAHTFFLCLEDNSGASFGVFLMNSNAMEFALQPAPAATYRTTGGI
LDFYVFLGDTPEQVVQEYVKLVGMPAMPSYWSLGFQLSRWNYTSLDELKVVVQRNRAIGI
PYEIQYTDIDYMEEKKDFTYDREKFKDLPNFAVDLHNHGQKYIIILDPAIATSRLLNNTP
YPSYDRGMNKKVWVNASDGITELIGEVWPGLTVFPDYTNPECTNWWIEECKLFYDQVKYD
GIWIDMNEISSFIRGSTDGCDPNNLNYPPFTPSILDGLMYSKTLCMDSVQSWGKHYDVHS
LYGYSMTLSTDKAIQAVFPGKRSLTISRSTFAGSGKYTGHWLGDNAATWNDLRWAIPGML
EFNLFGIPYIGADICGFFDNVTEELCRRWMQVGAFYPFCRNHNAENYAPQDPAVYGADSV
LVRSSKNYLNIRYTLLPYLYTLFYKAHTQGDTVVRPLLHEFYSDEATWAIDRQFLWGPGL
LITPVLDPGVETVTAYIPDAVWYDYETGGRVVWRKKQAEMYLPADKLGLHLRGGYIFPIQ
QPANTTLYSRKNPMGLIIALDDNKQAAGDLFWDDGESRGTVESKTYIYYQFSVTNNSLKM
NVLHKNYIDPNNLTFKEIKIFGLPLQPTTLTVFENGAVQNSPHNISYNPSNKVTHVTGLQ
LELGKSYSLEWNQELNDIERFDCHPSPNPTEQTCKALSCIWKPVSTGNVPSCYYPSDYGY
SVSQITYTSSGLSVNLNRNSNYANRAATSTTPINTLRLDVTYHDNNMLQFKIYDYNNKRY
EVPVRLNIPSSPTSTYENRLYEVAIQNNPFGIQIRRKSTGTIIWDSQVPGFTFSDMFIQI
STRLPSQYIYGFGENEHTTFRQDMNWHTWGMFAKDQPPGYKLNSYGVHPFYMGLENDGNA
HGVLLLNSNAMDVTFQPTPALTYRTIGGILDFYMVLGPTPELVVQEYTALIGRPVLPPYW
ALGFQLCRYGYKNDTEVSDLYEAMKAAQIPYDVQYTDIDYMERQLDFTLSPNFTGLPALV
DRMKKEGMRFIIILDPAISGNETNYLAYTRGVQEDVFIKWPNSSEIVWGKVWPDFPNVVV
NESLDWDTQVKLYRAYAAFPDFFRNTTAQWWQREIREYHTNPNQPEKSVKFDGLWIDMNE
PASFVHGSVEGCRNTDLNNPPYMPSLESRSLGLNHKTLCMESEQILPDGTPVRHYDVHNL
YGWSHVKPTYDALQSTTNERGIVVTRSTYPSSGKWAGHWLGDNTAAWDQLYKSIIGMMEF
SLFGISYTGADICGFFNDTEYYMCVRWMQLGAFYPFSRNHNTIGTRKQDPVSFDEQFENI
SRDVLNTRYTLLPYLYTLMYEAHVHGSTVVRPVLHEFVEDKETWDVYKQFMWGPALLISP
VLENATSVLAYIPNARWYDYYTEEQIAFKGQFHNLSAPLEHINLHIRGGYIIPWQDPANN
TFYSRQNSMGLTVALDDNGSAQGQLYWDDGNSIDAYEQGAYLLETFNASQHVLDIKVVHN
GYTDPNNLKFDEIKILGVAEEPLAVTVKQNGVTVPSLHNVNYTPTKKLLHITGLQLGLGK
PYSVDWSSVLIVEDNEKFNCYPDSGASQENCTARGCIWQVASNFLVPSCYYPSNYGYSVS
NVQNNDSGLTADLSRNLNIPDRYGDRSPSINTLRLEVKYHDNNMLQFKIYDANNKRYEVP
VPLFLPSTPTSTEAGRLYEVTIKNNPFGIEIRRKHTGTIIWDSQVPGFTFSDMFIQISTR
LPSQYVYGFGETEHTTYRRDMNWNTWGMFTKDQSPGYKLNSYGLHPFYMGLENDGNAHGV
LLLNSNAMDVTFQPTPALTYRTIGGILDFYMVLGPTPELVVQEYTALIGRPVMPPYWALG
FQLCRYGYKNDTEVSDLYEEMKTARIPYDVQYTDIDYMDRKLDFTLSPNFSGLPALVNRI
KEEGMRFIAILDPPISGNETNPYPAFTRGVQDDVFIKWPNSTEIVWAKVWPDYPNVVVNE
SLDLETQIELYRAYAAFPDFFRNSTAEWWQREIVEFHTNPDNPEKSIKFDGLWTDMNEPA
SFINGAVDGCREPLLNNPPYMPPLAEKEKGLDLVTLCMESQQFLPDGTPVRHYDVHSLYG
WSQAQPTYHAVRNATGERGIVITRSTYPSSGQWAGHWLGDNYARWDQLEKSIIGIMEFGL
FGISYIGADICGFFNDTTYEMCARWMQLGSFYTYSRNHNVIGTMRQDPVSFDEKFQNISR
DILNTRYTLLPYLYTLMHEAHVLGSTVTRPLLHEFVEDKKTWDIYKQFLWGPALLISPVL
SEGATEVNAYIPNARWYDYYTGKYLEVRGQLQTLPAPLEHINLHIRGGYIIPWQEPGLNT
NQSRQNFMGLTVALDDNKVAQGQLYWDDGISIDTYENGNYFLATFASSQSTVNMSVVHNN
FLTDTNPLNFGYVNIWGIGNQQITNVTITYDGQTHMITNFTSNQENQVLQIDFTEKIFSI
EKFTQLTWTTSN
NT seq 8139 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaagaagttcagcggattagaaatctccctgattgtcctattctgtttggtg
gtgattgtagcctgcattctggttggacttttagcaacaggacaatctggactccaagac
ttttctccagactgtccagcagtaagcttcacagagagaattgactgcattccagatcga
ggggcaacaaagagcttatgtacgctgcgtggctgttgctggagtccacaaaatgacaca
agcataccctggtgcttcttctccaagagtcatgggtataaagtagaaggaggtgtaaag
caaacaaatacaggtattgcagctaaattaacgagactgccttcaccttccctatttgga
aatgatattaccactgtccaactcacgggagaatatcagacaacaaatcgcttccggttc
aagatcactgatcctaataaaaaaagatttgaagttcctcatgagaacgtaaaagctttt
gatggacctgcagcctccaatttaaattataaagtcaatatcattcagaacccttttggt
atcactgtggtgagaacgagcagcagcaaaacactgttcgatactagcataggaccactt
cagtatgctgaccagtatttgcagctctcaatcaaactacccagcagcaacatttatgga
atcggagaacacgtccacacacaataccggcatgatgttaactggagaacgtggcccatc
tttaccagagatgctttccctaatggaggcactcataacttatatggagctcacactttc
ttcttgtgcttggaagataacagtggagcctcttttggtgtgttcttaatgaacagtaat
gccatggaatttgctctccagcctgccccagcagcaacttacagaacaactggtggaatt
ctagatttttatgtcttcttaggagatactccagagcaagttgttcaagagtatgtaaag
ctggtaggaatgcctgcaatgccttcatactggagtcttggattccaacttagtcgctgg
aattatacctctcttgatgaattgaaagttgtggtacaaagaaacagagcaattgggata
ccctatgaaattcaatacactgatattgactatatggaggagaagaaagactttacttat
gaccgagagaaatttaaggaccttcctaactttgctgtggacctacataaccatggacaa
aaatacattattatactggaccctgccattgccacctcccgtctccttaataatactcca
tatccttcctatgatcgaggaatgaacaagaaagtgtgggtaaatgcatcagatggaata
acagaactcattggagaggtgtggccaggcctgactgtgttccctgactacaccaaccca
gaatgtaccaactggtggatagaagaatgtaagctcttttacgatcaagtgaagtatgat
gggatttggattgacatgaatgaaatatccagctttataagaggttcaacagatggctgt
gacccaaacaatttaaactatcctcctttcactcccagtattctcgatggactcatgtat
tcaaagacactttgcatggattcagtgcaatcttggggaaaacactatgatgttcacagt
ctatatggatattccatgactctatctactgataaagctatacaagctgttttccctgga
aaaagaagccttactatttctaggtctacttttgctggatcaggcaaatacacaggacat
tggctaggggataatgctgctacatggaatgatctgagatgggcgataccaggaatgctg
gaatttaacctctttgggataccttatattggtgcagatatttgtggtttctttgataat
gtcacagaagaactttgcagacgatggatgcaagttggagcattttatccattctgcaga
aatcacaatgctgaaaattacgcgcctcaggatccggctgtatatggggcagattctgtt
ttggtgagatcatcaaagaactacttgaacattcgatacactttactgccctacctctac
acccttttttacaaagctcatacacaaggagacacagtagtgagaccacttcttcacgag
ttctattcagatgaagcaacgtgggctattgatcgacagttcttgtggggccctggtctt
cttatcactcctgtactggacccaggggtggaaacagtgacagcatatattcctgatgca
gtatggtatgactatgaaacaggtggaagagtagtatggagaaaaaaacaagcagagatg
tatctcccagcagacaaactaggacttcatctgagaggaggctacatttttcctattcag
caaccagctaatacaacattgtacagccgcaagaatccgatgggacttataattgcatta
gatgacaataaacaagcagctggagatttattctgggatgatggagaatctagaggtaca
gtggaaagtaaaacctacatttattaccagttttcagttaccaataatagcttaaaaatg
aatgttttgcacaagaactacatcgatcccaacaacttaacgtttaaggaaatcaaaatc
tttggattgccccttcaacctacaactcttaccgtgtttgaaaatggtgcggtgcagaat
tctcctcataatatcagctataatccttcaaataaggttacccatgtaactgggcttcaa
cttgaactaggaaaatcatactcactggaatggaatcaagagttaaatgacattgaaaga
tttgattgtcaccctagtcccaatccaacagaacagacatgtaaagccttgagctgtatc
tggaagcctgtttccactggtaatgtgccatcctgttactacccttctgactatggttat
tctgtcagtcaaattacatacacctcttcaggtttatcagtgaacctcaacagaaatagt
aattatgctaatcgtgctgcgacttctactacccctatcaatacacttcgtttggatgtg
acatatcatgacaacaatatgctgcaatttaagatttatgattacaacaataaaagatat
gaggttccagtacgactaaatattcctagcagtcctacaagtacatatgagaatcgactc
tatgaagtagcaattcagaacaatccattcggcatccagattcgacgcaaaagcactggg
acaattatttgggattctcaggtacctgggttcacctttagcgacatgttcattcagatt
tctacccgtctgccatcacagtatatctatggatttggtgaaaatgaacacactacattt
cggcaagatatgaactggcacacctggggaatgttcgccaaagaccagccccctggttac
aaactgaattcttatggtgtccatcctttttacatgggcttagaaaatgatggaaatgct
catggagtcctcttgcttaacagcaatgcaatggacgtcacattccagccaactcctgct
ctgacatatcgcactatcggaggaattctggacttttacatggtgttgggcccaacgcca
gagcttgttgttcaggaatacactgcactgattggacgaccagtcctgccaccgtactgg
gctttgggattccagttatgccgttatggatacaaaaatgacacagaagtctctgacctg
tacgaggcaatgaaggcagctcagataccttatgatgtacaatacacagatattgattac
atggaacggcaattagactttaccctcagcccaaacttcactggactaccagctctggtt
gacagaatgaaaaaggaaggaatgcgattcatcattatcctggatccagccatttcaggc
aacgaaaccaattatctagcctacacaagaggtgtccaggaagatgtttttattaaatgg
cccaatagcagtgaaattgtgtggggaaaggtttggccagattttcccaatgtagttgtt
aatgaatcgctagactgggacactcaagtgaagctatacagagcttatgcagctttccca
gatttcttccgcaacaccacagctcagtggtggcaaagagaaataagagaataccacact
aacccaaatcaaccagagaaaagtgtgaagtttgatggcttgtggattgacatgaatgaa
ccagcaagctttgttcatggatcagtcgaaggctgtagaaacacagatctaaacaatcct
ccctatatgcccagtttggaatcacggtcacttggattgaatcacaaaaccttatgcatg
gaaagcgagcagatcctgccagatggaacccctgttagacactatgatgtgcataatctc
tatggatggtcacatgtaaaacctacctatgatgctttacagagcaccactaatgaacgt
ggaattgttgtcacccgttcaacatatccctctagtggaaaatgggctggacactggctt
ggtgataacaccgcagcttgggatcaactttataaatctataattggtatgatggaattc
agcctttttggaatatcctatactggagcagacatttgtggcttcttcaatgatacagag
tattacatgtgtgtccgttggatgcagctgggagcattttacccattttccagaaatcat
aataccataggcaccaggaagcaagatcctgtttcctttgatgaacaatttgaaaatatt
tccagagatgtactcaatacaagatacacactgttaccttatctctacactttaatgtat
gaagctcacgttcatggtagcactgtagtgcgtcctgtcctccatgagtttgtggaagac
aaagaaacatgggatgtatacaaacaatttatgtggggacctgcactgctcattagccct
gtactggagaatgctacatccgtgttggcttatatacccaatgcacgctggtatgattat
tacacagaggaacagattgcattcaagggacagttccacaacctatcagctcctcttgaa
catatcaaccttcatatccgcggaggttacatcatcccatggcaggaccctgctaataat
accttttacagccgacaaaactcaatgggacttactgttgctttagatgataatgggtcc
gctcaaggtcagctttactgggatgatgggaacagcattgatgcatatgaacagggtgct
tatctgttagaaacatttaatgcaagtcagcatgttttagatattaaggttgtgcacaat
ggatacactgacccaaacaatttaaaatttgatgaaattaaaatcttgggagttgccgaa
gaacctttagctgttacagtaaaacaaaatggtgtgacagttccatctctccataatgtc
aactatactcctacaaaaaagctgctgcatattactgggcttcagcttggactagggaaa
ccatactcagtggactggtcttcggtcctcattgttgaagacaatgaaaaatttaactgt
tatcctgactcaggtgcatcacaagaaaattgtactgctcgtggctgtatctggcaggtg
gcctctaacttccttgtaccatcatgttactacccaagtaattatggctattctgtcagt
aacgttcaaaacaacgattcgggtcttacagctgacctctccagaaatcttaatatccct
gaccgctatggggatcgttctccctctatcaacacacttcgcttggaagtgaaatatcat
gacaacaacatgttgcagttcaagatttatgatgccaacaataaaagatatgaagttcca
gtaccactattcctccctagtactccaacaagtacagaagcaggtcgactctatgaagtg
actattaagaacaatccatttggtattgagattcggcgcaaacacactggaacaattatc
tgggattctcaggtacctggcttcacctttagcgacatgttcattcagatttctacccgt
ctgccatcacagtatgtctacggatttggtgaaactgaacacactacatatcggcgtgat
atgaactggaatacctggggaatgtttacgaaagaccagtcccctggttacaaattgaat
tcctatggtttgcatcccttttacatgggcctggaaaatgatggaaatgctcatggagtc
ctcttgcttaacagtaatgcaatggatgtcacattccagccaactcctgctctgacatat
cgcactattggcggaattctggacttttacatggtgttgggcccaacgccggagttggtt
gttcaggaatacactgcactgattggacgaccggtcatgccaccatactgggctttggga
ttccagttatgccgttatggatacaaaaatgacaccgaagtctctgacctgtatgaggaa
atgaagacagctaggataccttatgatgtacagtatacagacattgattacatggaccgg
aagttagactttactctcagcccaaacttttctggacttcctgctctggttaatcgaata
aaagaagaaggaatgagattcatcgctattctggacccacctatttcgggcaatgagaca
aatccttatccagctttcacaagaggtgtgcaggatgatgtcttcatcaaatggcctaac
agcactgagattgtctgggcaaaggtttggccagattatcctaatgtagtagttaatgag
tctctagatttagaaacacagatcgagctgtacagagcttatgcagctttcccagatttc
ttccgcaattctacagcagagtggtggcaaagagaaatagtagaattccacactaatcca
gataatccagagaagagtataaaatttgatggcctgtggactgacatgaatgaaccagca
agctttattaatggagcagttgatggctgccgagaaccacttctaaacaacccaccttat
atgccacctttggcagaaaaggaaaaagggctggatctcgtgaccttgtgcatggaaagt
caacagtttctgccagatgggacccctgtgaggcactatgatgtacacagtctgtatgga
tggtcacaggcacaacctacctaccatgctgtacgcaatgctacaggggaacgtggaatt
gttatcacccgatcaacgtatccctctagtggacaatgggcaggtcactggcttggtgat
aactatgcaagatgggaccagcttgaaaaatctattattggtataatggagtttggcctc
tttggaatttcctatattggagcagatatctgtggcttcttcaatgatacaacatatgaa
atgtgtgcccgctggatgcagcttggatcattttacacctattctagaaatcataatgtg
ataggaactatgaggcaagatcctgtttcctttgatgaaaaatttcaaaatatttccagg
gacatactcaatacaagatacacactgttaccttatctctatactttaatgcatgaagct
catgttcttggtagcactgtaacacgtcctctgcttcacgagtttgtggaagacaaaaaa
acgtgggatatatacaaacagtttttgtggggcccagcactgctgattagccctgtattg
agtgaaggagctacagaagtgaatgcttatatacccaatgcacgctggtatgattattac
acgggaaaatatcttgaagtaagaggacaattacagacattgccagcacctcttgagcat
atcaatcttcatatccggggcggttacatcatcccctggcaagaacctggtcttaatacc
aatcaaagccgacaaaactttatgggacttactgttgctttggatgataacaaggtcgct
caaggtcagctttactgggatgacggaataagcattgacacatatgaaaatggtaattat
ttcttagcaacatttgcctcaagccagagtactgttaatatgagtgtggtgcacaacaac
ttcctaactgacacaaatccattgaattttggctatgtgaacatctggggaataggaaac
caacagattacaaatgttactatcacttatgatggacagacacatatgattactaacttc
acaagtaaccaagaaaatcaggtgctacaaattgattttactgagaaaatattcagcatt
gaaaaatttacacaacttacatggacaacaagcaattaa

DBGET integrated database retrieval system