KEGG   Chrysemys picta (western painted turtle): 101936670
Entry
101936670         CDS       T04662                                 

Gene name
EGR1
Definition
(RefSeq) early growth response 1
  KO
K09203  early growth response protein 1
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04371  Apelin signaling pathway
cpic04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101936670 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101936670 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cpic03000]
    101936670 (EGR1)
Transcription factors [BR:cpic03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    101936670 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Zf_RING zf-BED zf-C2H2_8 zf-H2C2_5
Other DBs
NCBI-GeneID: 101936670
NCBI-ProteinID: XP_005282279
LinkDB
Position
Un
AA seq 508 aa
MAAAKAEMQLLPQLQISDPFGSFPHSPPTMDSNYPKLEEMMLLSGGGPQFLTSSGAPESS
GFNPPGEQHFEHLAADTFPEISLNNEKSLAETSYPNQTSRLPPITYTGRFSLEPAPNSSN
TLWPEPLFSLVSGLVGMANLPTTSTPSSSPTSSSSQTPPLSCSVQASDNSPIYSAAPTFP
NSSSEIFPEQQTQSFPNAPSTSLQYPPPAYPAAKTNFQVPMIPDYLFPQQQGESLSLVPA
DQKPFPTLESRPQQPSLTPLSTIKAFATQTGSQDPKTLNTTYQSQLIKPSRIRKYPNRPS
KTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRT
HTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKAEKATPASAASQISTYSSPMTTSY
PSPATTTYPSPVPTSYSSPVSSSYPSPAHTTFPSPSVATTYPSVTATFQAQVSTTFPSPG
ITNSFNSQGTSALSEMSSTFSPRTIEIC
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggccgcggccaaggcggagatgcagctcctaccacagctgcagatctctgaccccttc
ggctcctttccacactcgccccccaccatggacagtaactaccccaagctggaagagatg
atgctgctcagcggcgggggtccccagttcctcacctccagcggggcccctgaaagcagc
ggtttcaacccccccggagaacagcacttcgagcaccttgctgcagacacgtttcccgag
atctctttaaataatgagaaatccttggcagaaaccagctaccccaatcagacaagccgg
ctgccgcctataacctacacgggccgcttctctctggaaccagcccccaacagcagcaac
actctctggccagagcctctgttcagccttgttagtgggctggtgggcatggctaaccta
cccaccacttctacaccttcttcatcaccaacctcctcatcctcacagaccccgcccctg
agctgctctgtccaggccagcgacaacagcccgatctattcagcggcaccaacatttcct
aattctagctctgagattttccctgagcagcaaacccagtccttcccaaacgctcccagt
acctctctccagtaccctcccccggcttatccggctgctaaaaccaacttccaggtgcca
atgatcccggactacttattcccccagcaacagggggaatctctcagcctggtcccagct
gatcagaaaccatttccaacgctagaatccagaccccagcagccctctctcacacctctc
tccactatcaaagcttttgctacccagactgggtcccaagatccgaagacgctaaacact
acgtatcagtcgcagctaatcaagccaagcaggataagaaaataccccaaccgacctagc
aagacccctcctcacgagagaccctacgcatgcccagtggagtcctgtgacaggaggttt
tccagatctgatgagctgacccggcacattcggattcacacaggacaaaaaccttttcag
tgccgtatttgtatgaggaatttcagcagaagcgatcacttgaccactcatatccgaacc
cacaccggggagaagccatttgcctgtgatatttgtggtagaaagtttgccagaagcgat
gagaggaagagacacactaaaattcacctgagacagaaggacaagaaagcagaaaaggca
actccagcctctgctgcttctcagatttccacctactcctctccaatgacaacttcctac
ccatctccagccaccaccacttacccatctccagtgcctacatcatattcctccccagtg
tcttcttcctatccatctccagcacacaccactttcccttccccctcagtagcaactaca
tatccttcggttactgccacctttcaggcccaagtatctaccactttcccctctccaggg
attaccaattctttcaattcacaagggacttcagcactttcagaaatgtcatcaactttt
tctccaaggacaattgaaatttgttga

DBGET integrated database retrieval system