KEGG   Chrysemys picta (western painted turtle): 101937304Help
Entry
101937304         CDS       T04662                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic03030  DNA replication
cpic03410  Base excision repair
cpic03420  Nucleotide excision repair
cpic03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101937304 (LIG1)
   03410 Base excision repair
    101937304 (LIG1)
   03420 Nucleotide excision repair
    101937304 (LIG1)
   03430 Mismatch repair
    101937304 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cpic03032]
    101937304 (LIG1)
   03400 DNA repair and recombination proteins [BR:cpic03400]
    101937304 (LIG1)
Enzymes [BR:cpic01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101937304 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     101937304 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101937304 (LIG1)
DNA replication proteins [BR:cpic03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101937304 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101937304 (LIG1)
DNA repair and recombination proteins [BR:cpic03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101937304 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     101937304 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     101937304 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 101937304
NCBI-ProteinID: XP_008173935
LinkDB All DBs
Position
Un
AA seq 948 aa AA seqDB search
MQRPITSFFQPMKAVKEEEKIRPPAEEDSTSQVSEAAVPQRNGLSLCVDSPVKSTAKRPL
RRVLESDSDEEEAVLTAQAEVSPIQDKSSEKASSKQEPMQTPQSDLSADSPSPSSSHSAG
DSPALSDSPAIGHAGIPRRRTARKQIPKRKIELPTSRENNRHEEPSAKRCREEQGPGDEA
GRRAKEEDAMEMQEVKGQHSAEVNGASEEGAVNKGEEDHAGGGAQEKPEPPKPSRAISSF
FAPKKVPVAKAGKADERAAVKIPPAPTGSATVSSNGSDGTAGSFSKPAVPLDPVEYNPSK
SSYHPVQDACWGHGQRVPYLAVARTFERIEEVSARLKNIETLSNLFRSVIALSPSDILPC
IYLCLNRLGPAYKGLELGIGETILMKAVAQATGRQLDQIKAEAQEKGDLGLVAESSRSNQ
RTMFTPPKLSAAGVFSKLQEIARMTGSASMNKKIDIIKGLFVACRHSEARYITRSLGGKL
RIGLAEQSVLSAIAHAVSLTPPGQGFPPEVLDAGQGKSAETRKAWLEEQTQILKQTFCEL
PSYDIIVPILLEHGVESLPQHCKITPGIPLKPMLAQPTKGIGEVLKRFEEAAFTCEYKYD
GERAQIHILENGDVHIYSRNQEDNTSKYPDIISRIPKVKKGSVRSCILDAEAVAWDPEKR
QIQPFQVLTTRKRKDVEAAEIKVQVCLYAFDILYLNGESLVKEPFSRRRQLLHESFVETE
GELMFATSMDTCSLDEISEFLDQSIKDSCEGLMVKTLEVDATYEIAKRSHKWLKLKKDYL
EGVGDTLDLVVIGAYLGKGKRVGMYGGFLLACYDEESEEYQSICKIGTGFTEESLEKHYN
FLKDHVLEKPRPYYRWDSSTEPNHWLAAVQVWEVKCADLSISPVHKAAIGLVDEEKGISL
RFPRFLRVRDDKKPEEATTSSQVAELYRQQQQIQNQQPAEKAEEEDFY
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcccgatcacgtcatttttccagcccatgaaggcagtgaaggaggaggagaag
atcagaccgccagcagaagaggactcaaccagccaggtgtcagaggcagctgtgccgcag
agaaatggcctaagcctctgtgtggactccccagtgaaatccactgccaagaggcccctg
cgtcgggtcttggagagcgacagtgacgaggaggaggccgtgctgacagcccaagcagag
gtttctcccatacaggacaaaagctcagagaaagctagcagcaagcaggagcctatgcaa
actcctcagtctgatctctctgcggatagcccctcaccaagcagtagccactccgctgga
gacagcccggccctttctgactcccctgccatcggccatgctggcatccccagacgcagg
accgctcgcaagcagatccccaaacgcaaaatagagttgccaactagcagggagaacaac
aggcatgaggagccgagtgccaagagatgccgggaagagcaaggcccaggagatgaggca
ggcaggagagcaaaggaagaagacgccatggaaatgcaagaggtgaaaggtcagcattcg
gctgaagttaatggcgcttcagaggagggggctgtgaacaagggagaagaggaccacgct
ggagggggagcccaggagaagcctgagccacccaagcccagcagagccatctccagcttc
tttgcccccaagaaggtgccagtggcaaaggcagggaaggcagatgaacgtgcagcagtg
aaaataccacctgccccaactggctcagccacagtgagcagcaatgggagtgatggcaca
gctggcagtttctccaagccagctgtgccactggaccccgtggagtacaatccttcgaag
agcagctatcaccctgtccaggacgcctgctgggggcatggtcagagggtcccctacctg
gctgtggctcggacatttgagcggatcgaggaggtgtctgcccggctgaagaacattgag
accctgagcaacctcttccgctcagtgatcgccctgtcaccatctgacattctgccctgc
atctacctctgtctgaaccgcctgggccctgcctacaaggggctggagctgggcatcggc
gagaccattctcatgaaggctgttgcacaggcaacaggacgccagctggatcagatcaaa
gccgaggcccaggagaagggggatctgggcttggtagctgagagcagccgcagcaaccag
cgcaccatgttcacgccacccaagctgagtgctgccggagtcttcagcaagctacaagag
attgccaggatgacaggcagtgcttccatgaacaagaagatcgacatcatcaaagggctg
tttgtggcctgccggcactcggaagctcgctacatcactcggtccctgggcgggaagctt
cggattgggctggcagagcagtcagtgctgtcagccattgcccatgccgtgtctcttact
cccccaggacaagggtttcccccagaggtgctggatgctggccagggcaaatctgcagag
acacgcaaagcctggctggaggagcagacccagatcctcaagcagaccttctgtgagttg
cctagctatgacatcatagttcccatcctgctggagcatggagtggagagcctgccacag
cactgcaagatcaccccagggatcccgctgaagcccatgctggcccagcccaccaagggc
attggggaggtgctgaagcgctttgaggaggctgccttcacctgcgagtacaagtatgat
ggggagcgagcccagatccacatcctggagaatggggatgtgcacatctacagccgcaac
caggaggacaacacctccaaataccctgacatcatcagtcgcatccccaaggtgaagaag
ggcagcgtgcggtcatgtatcctggatgctgaggccgtggcctgggaccccgagaagagg
cagattcaacccttccaggtcctgaccacgcggaaacgcaaggatgtggaagctgctgag
atcaaagtgcaggtgtgtctgtatgccttcgacattctgtacctcaatggggagtcccta
gtgaaggagccattctccaggcgccgtcagctgctgcatgagtcttttgtggagacagag
ggggagttaatgtttgccacctccatggacacctgcagcctggacgagatctctgaattt
cttgaccagtccattaaagactcctgcgagggactcatggtcaagaccctggaggtggat
gccacgtacgagatcgctaagagatcccacaagtggctgaagctgaagaaggattacctg
gaaggtgttggtgacactctggacttggtggtgattggtgcctatctgggcaagggcaag
cgagtaggcatgtatggcggcttcctgttggcctgctatgatgaggagagtgaggagtac
cagagcatctgcaagattgggactggcttcacagaagagagcctggagaagcattacaac
ttcctgaaggaccatgtgctagagaagccacggccctattaccgctgggacagcagcact
gagcccaaccactggctggcagctgtgcaggtgtgggaagtgaagtgtgctgacctgtcc
atctcgcctgtgcacaaggcagctataggcctggtggatgaggagaagggcatctccctg
cgctttccccggttcctgcgcgtgcgtgatgataagaagcctgaggaagccaccaccagt
tcccaggtggctgagctctacaggcagcagcagcagattcagaaccagcagcctgcagag
aaagctgaggaggaggacttctactag

DBGET integrated database retrieval system