KEGG   Chrysemys picta (western painted turtle): 101937706Help
Entry
101937706         CDS       T04662                                 

Gene name
CNIH3
Definition
(RefSeq) cornichon family AMPA receptor auxiliary protein 3
  KO
K20368  protein cornichon
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpic04131]
    101937706 (CNIH3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpic02000]
    101937706 (CNIH3)
Membrane trafficking [BR:cpic04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    101937706 (CNIH3)
Transporters [BR:cpic02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   101937706 (CNIH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 101937706
NCBI-ProteinID: XP_005289640
LinkDB All DBs
Position
3
AA seq 160 aa AA seqDB search
MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERI
CFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLVFYHFWRYFHCPADSSELAYDPP
AVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggccttcactttcgctgccttttgctacatgctgtccctggtgctgtgcgctgccctc
atcttcttcgccatctggcatataatcgcctttgatgagctaaggacagacttcaagagc
ccgatagaccagtgcaatccagttcatgcacgagagagactaagaaacattgagcgcatc
tgctttcttctgcgaaagctggtgctgcctgagtattctatccatagccttttctgcatc
atgttcttgtgtgctcaggaatggctaaccctggggctgaatgttcctctggttttctat
cacttttggaggtatttccattgcccagcagatagttcagagcttgcatatgatccacct
gcagtcatgaatgcagacaccttgagttactgtcagaaagaagcatggtgtaaactagct
ttctatctcctttccttcttctactatctttactgcatgatctacactttagtgagctct
taa

DBGET integrated database retrieval system