KEGG   Chrysemys picta (western painted turtle): 101937973Help
Entry
101937973         CDS       T04662                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00010  Glycolysis / Gluconeogenesis
cpic00053  Ascorbate and aldarate metabolism
cpic00071  Fatty acid degradation
cpic00260  Glycine, serine and threonine metabolism
cpic00280  Valine, leucine and isoleucine degradation
cpic00310  Lysine degradation
cpic00330  Arginine and proline metabolism
cpic00340  Histidine metabolism
cpic00380  Tryptophan metabolism
cpic00410  beta-Alanine metabolism
cpic00561  Glycerolipid metabolism
cpic00620  Pyruvate metabolism
cpic01100  Metabolic pathways
Module
cpic_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cpic_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101937973 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    101937973 (ALDH7A1)
   00620 Pyruvate metabolism
    101937973 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101937973 (ALDH7A1)
   00561 Glycerolipid metabolism
    101937973 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101937973 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    101937973 (ALDH7A1)
   00310 Lysine degradation
    101937973 (ALDH7A1)
   00330 Arginine and proline metabolism
    101937973 (ALDH7A1)
   00340 Histidine metabolism
    101937973 (ALDH7A1)
   00380 Tryptophan metabolism
    101937973 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101937973 (ALDH7A1)
Enzymes [BR:cpic01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101937973 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     101937973 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     101937973 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 101937973
NCBI-ProteinID: XP_005310780
LinkDB All DBs
Position
Un
AA seq 539 aa AA seqDB search
MLQLSFALSRHVLLRKRLLASCKRPAAFMSTLLINQPQYAWLKDLGLKEENEGVYNGIWG
GRGELVTTCCPANDEPIASVRQASLEDYEETIKKAKEAWKIWADVPAPKRGEIVRQIGDA
LRKKIKDLGSLVSLEMGKIFVEGVGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNACLWKGAPTTSLISVAVTKIVAKVLED
NKVPGAICSLICGGADIGTAMARDERVDLLSFTGSTKVGKQVALMVQERFGRSLLELGGN
NAIVVFEDADLNLVIPSALFAAVGTAGQRCTSARRLFLHESIHDEVVEKLAKAYAQVRIG
DPWDSTTLYGPLHTKQAVMMFLDAVEQAEQQGGSVVYGGKVLNRPGNYVEPTIVTDLPHN
ASIVHTETFAPILYVLKFKTEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGV
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKLYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagctaagctttgctctctccaggcacgttttactgaggaagagacttttagca
tcttgtaagaggcctgctgcattcatgtctactttgctgatcaatcagccccagtatgcg
tggttgaaagacctgggactgaaagaagaaaatgaaggcgtgtataatgggatctgggga
ggaagaggagagcttgtgacaacatgttgcccagctaatgatgagccaatagcaagtgtg
cgacaggccagcttggaggactatgaagaaacaataaagaaagctaaagaggcatggaaa
atatgggcagatgttcctgcacctaaacgtggagaaatagtgaggcagattggcgatgcc
ttgagaaagaaaatcaaagatctgggaagcttggtctcactagagatgggaaagattttt
gtcgagggtgttggcgaagttcaggaatatgttgatgtctgtgactatgctgttggcttg
tcccgaatgatcggtggacctgtcttgccttcagaaagacctggccatgcccttatagaa
cagtggaatcctgtgggattggtaggaattatcactgcgtttaacttccccgtagcagtg
tatggttggaataatgcaattgcaatgatctgtgggaatgcttgcctctggaaaggtgct
cctacaacgtccctcattagcgtagctgttacaaagatagtagccaaagttttggaggat
aacaaagtgcctggtgcaatctgctccctgatatgtggtggagcagatatcggcacagca
atggcaagagatgagagagtggacctgctgtctttcactggcagcactaaggtgggcaag
caggtggcacttatggttcaagagagatttggacggagtctgttagagcttggtggaaac
aacgccattgttgtgtttgaagatgcagatcttaacctagtcatcccctctgctctattt
gctgctgtggggacagcaggccagagatgcacaagtgccagaaggctgttcttgcatgaa
agcatccatgatgaggtggtggagaaacttgctaaggcctatgcacaggttcgcatcggc
gacccatgggactccaccactctgtatgggcctctccacactaaacaagcagtgatgatg
ttccttgatgcagtggaacaagccgaacagcagggtggctctgtggtgtatggtgggaag
gttctaaatcgccctggtaactatgttgaaccaacaattgtgactgaccttccccataat
gcatccatcgtgcacactgagacatttgcccccattctttatgtgctgaaattcaagaca
gaagaagaggtctttgcttggaataatgaagtaaaacaaggtctctctagcagcattttc
accaaggatttgggcaggattttccgctggcttgggcctaagggatcagactgtggtgtt
gtaaatgtcaacattccaaccagtggggctgaaattggaggtgcttttggtggtgaaaag
cacactggcggtggaagagaatctggcagcgattcatggaaactgtacatgagaaggtcc
acttgtacaatcaactacagcaaggatttgcctttggctcaaggaatcaagtttcaataa

DBGET integrated database retrieval system