KEGG   Chrysemys picta (western painted turtle): 101938764
Entry
101938764         CDS       T04662                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04012  ErbB signaling pathway
cpic04068  FoxO signaling pathway
cpic04110  Cell cycle
cpic04115  p53 signaling pathway
cpic04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101938764 (CDKN1A)
   04068 FoxO signaling pathway
    101938764 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101938764 (CDKN1A)
   04115 p53 signaling pathway
    101938764 (CDKN1A)
   04218 Cellular senescence
    101938764 (CDKN1A)
SSDB
Motif
Pfam: CDI TetR_C_8 RPA_interact_C
Other DBs
NCBI-GeneID: 101938764
NCBI-ProteinID: XP_005280550
LinkDB
Position
4
AA seq 155 aa
MPLSQSNMRQAPCNRKLCRNLFGPVDHEQLQNDLQDLMRRHLEEAQCRWNFDFETETPLE
GKFKWERVLYPDVSPACLPSQDPSHSKGNGGEKNQSSPALKISTKDLNMALSSETVQMDS
ESCKASSPRHLKRKQTSIKDFYSSKRRIVPCKPNP
NT seq 468 nt   +upstreamnt  +downstreamnt
atgcctctgtcacagagtaacatgcggcaggccccctgcaacaggaagctctgccgaaac
ctctttggcccggtggatcatgagcagctccagaatgacttgcaggatttgatgaggaga
catctggaagaagctcagtgcaggtggaattttgactttgagacggaaacaccgctggag
ggcaagttcaagtgggagagagtcctctatcctgacgtgtctcctgcttgcctgccttct
caggacccgagccactccaaaggtaatggtggggagaagaaccagagctctccagcactt
aagatttctacaaaggatcttaacatggccctctcaagtgaaacagtacagatggactct
gagtcctgcaaggccagctccccaaggcacctgaaacgaaagcagaccagcataaaagat
ttctacagttcaaagcggaggattgtcccttgcaaaccaaatccgtga

DBGET integrated database retrieval system