KEGG   Chrysemys picta (western painted turtle): 101938880
Entry
101938880         CDS       T04662                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
cpic  Chrysemys picta (western painted turtle)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 PHD
Other DBs
NCBI-GeneID: 101938880
NCBI-ProteinID: XP_008162409
LinkDB
Position
Un
AA seq 364 aa
MIELKNLELEKRIDLTREPRGTPERPVRLERTNALRITPGKVPELLSRVRQIRLLGGQSD
PRLTGQLGEGHAFRPCTRGQQTWCDLCGDFVWGGPRKSLQCAHCKFTCHYRCRALIRLDC
SGPRYQDSDPDEANEQTVEKDTNVDEQIDWEKPVLTQAEIEQKIKEYNSQINSNLFMSLN
KDGSYTGFIKVQLKLIRPVSVPASKKAPSIQDVNKAPRSQVVTRRTSFYLPKDTVKHLHI
ISRTRASEVIEALLKKFMVVDNPRKFALFERAEKDDQVYLRKLSDEEQPLHLRLLAGPNE
KVLSFVLKENETGEVNWDAFSMPELHNFLRILQREEEEHVRQILHKYACCRQKMQEALTT
RTPG
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgatcgagctgaagaacctagagctagagaagcggatcgacctgacccgcgagccccgg
ggtacgccggagcgccccgtgcgcctggagcgcaccaacgccctacgcatcacgcccggc
aaggtgcccgagctcctgagccgcgtgcggcagatccgtctgctgggcgggcagagcgac
ccccggctgacgggccagctgggcgagggccacgccttccggccctgcacccgcggccag
cagacttggtgcgacttgtgtggagatttcgtctggggaggcccccggaagagcctgcag
tgcgcccactgcaagttcacctgccactatcggtgccgtgccctgatccggctagactgc
agcggcccccggtaccaggacagtgacccggacgaggctaatgaacagactgtggagaaa
gacaccaacgtggatgagcagattgactgggagaagccggttctgacccaagccgagatt
gagcagaagataaaggaatacaacagccagatcaacagcaacctcttcatgagcttgaac
aaagatggctcctacactggcttcatcaaggtgcagctgaagctgattcggccggtctcg
gtgccagccagcaagaaggcgccctccattcaggacgtcaataaggcaccgcgctcccag
gtggtgacgcgccgcacgtccttctacctgcccaaggacacggtcaagcacctgcacatc
atctcccgcacccgcgccagcgaggtcatcgaggccctgctcaagaagtttatggtggtt
gacaacccccgcaagtttgctctcttcgagcgagctgagaaggatgaccaagtgtacctg
cggaagctctcagacgaggagcagcccctgcatctccggctgctggctggccccaacgag
aaggtcctcagcttcgttctgaaggagaacgaaaccggagaggtcaattgggatgccttc
agcatgcccgagctgcacaacttcctgcgcatcctgcagcgcgaggaggaggagcacgtc
cggcagatcctgcacaagtatgcctgctgccgccagaagatgcaggaggcactgactacc
cgcaccccgggctga

DBGET integrated database retrieval system