KEGG   Chrysemys picta (western painted turtle): 101939182Help
Entry
101939182         CDS       T04662                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00500  Starch and sucrose metabolism
cpic01100  Metabolic pathways
cpic04910  Insulin signaling pathway
Module
cpic_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101939182 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101939182 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cpic01003]
    101939182 (GYS2)
Enzymes [BR:cpic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101939182 (GYS2)
Glycosyltransferases [BR:cpic01003]
 Polysaccharide
  Storage polysaccharide
   101939182 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 101939182
NCBI-ProteinID: XP_008163989
LinkDB All DBs
Position
6
AA seq 702 aa AA seqDB search
MPLVRSLSVTSLNGLPQWEDEDLPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKITTDEWG
ENYFLIGPYFEHNVKTQVEVCEPPNPAIKKAVDTLKGQGCQVFFGRWLIEGSPYVMLFDI
GSAAWNLDRWKGEFWDACNIGIPFNDREANDALIFGSLTAWFFKELTSQFDDKPNLIAHF
HEWQAGAGLILSRFRKLPVATVFTTHATLLGRYLCAASIDFYNKLDQFDIDKEAGEREIY
HRYCMERASVHCAHVFTTVSQITAIEAEHMLKRKADVVTPNGLNIKKFSAMHEFQNLHAM
YKARIQEFVRGHFYGHLDFNLARTLFFFIAGRYEYSNKGADLFLEALSRLNFLLRVHRSD
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQCVKEKFGKKLYDALLKGEIPDLNKI
LDRDDVTIMKRAIFSTQRQSLPPVTTHNMIDDSNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPMDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPAAYGIYIVDRRYRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPNAPPKTEGFRYPRPSSVPPSPSVSQHSSPHHSED
EDEDERYDEDEEAERDRQNIKSPLSLGALPQRKKKQHGEYRN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgcctctggttagatcactgtctgtgacctctcttaatggacttcctcagtgggaggat
gaagacctgccagtggaggatttattgctctttgaagtcgcttgggaagttaccaataaa
gttggtggcatctacactgtgatccagacaaaagccaaaattacaactgacgaatggggt
gaaaattattttctgatcggtccctactttgagcacaacgtgaagactcaggtagaggtg
tgcgagcctccgaacccagcaattaaaaaggcagtggacacgttgaaaggccaggggtgt
caggtattttttggaagatggctgatagaaggcagcccatacgttatgctctttgacata
ggatcagcagcctggaatctggacagatggaaaggagaattctgggatgcatgcaacata
ggaatcccttttaatgacagagaagccaacgatgcactgatctttggatcattgactgcc
tggttctttaaagagctcaccagccagtttgatgacaagcccaacttgattgctcacttt
catgaatggcaggcaggtgctgggctaatcctctctcgatttaggaaacttcctgttgcc
acagtctttactacccatgccacactgctcgggaggtacctgtgtgcagcaagtatagat
ttctacaacaaacttgaccagtttgacatagacaaagaagcaggagagagagagatttac
catcggtactgtatggaacgggcgtctgtacattgtgcccatgttttcaccacggtttct
cagataacagccatagaagcagaacacatgcttaagagaaaagccgatgttgttactcca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcatgccatg
tacaaggctaggatccaagagttcgttcgaggccatttctatggccatcttgacttcaac
cttgcaaggaccttgtttttcttcatcgctgggagatacgaatattcaaacaaaggagct
gatttgtttctagaggccttatccagattaaacttcctgctgcgggttcacagaagtgat
gttacagtcgtagtgttcttcatcatgccagcaaagacgaacaatttcaatgtggaaaca
ctgaaaggccaagcagtacgaaagcaactatgggacaccgcacaatgtgtgaaagaaaaa
tttggaaagaaactctacgatgcactactgaagggagaaattccagatttgaacaagatc
cttgaccgggatgatgtaaccattatgaaaagagccatcttttcaactcagcgacagtct
ctgcctccagtaaccacccacaacatgatcgatgattccaatgacccgatcctcaatacc
attcggcgcatcggactcttcaataaccgcacagacagagttaaggtgatattacaccca
gagttcctgtcttcaacaagtccattattacccatggactatgaagattttgtcagaggc
tgccatttgggggtgtttccctcatactatgagccttggggttacactccagctgagtgc
actgtgatgggcattcccagtgtgaccacaaacctctctggatttggctgtttcatgcag
gagcatgtagctgacccagctgcttatggtatttacatagttgacaggaggtaccgctct
cccgatgagtcatgtaaccagctgactcagttcttgtatggattttgccagcagtcacgg
cgtcagaggatcatccagagaaatcgaactgagaggctctcagacctactggactggaga
tatttaggcaggtactacatgcatgccagacacctggctctgagcagaactttcccagat
aaatttgagatggaaccaaatgctccaccaaagacggaaggtttcaggtaccccaggcct
tcatcagtaccaccatcgccttctgtctctcagcattccagccctcatcatagcgaggat
gaagatgaggatgaaagatacgacgaggatgaagaggccgaaagagacagacaaaacata
aagtcacctttgtcccttggagcactgccacaaagaaagaaaaagcagcatggagaatat
aggaactga

DBGET integrated database retrieval system