KEGG   Chrysemys picta (western painted turtle): 101939693
Entry
101939693         CDS       T04662                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04010  MAPK signaling pathway
cpic04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101939693 (TGFA)
   04012 ErbB signaling pathway
    101939693 (TGFA)
SSDB
Motif
Pfam: Trp_oprn_chp TMEM154
Other DBs
NCBI-GeneID: 101939693
NCBI-ProteinID: XP_005285272
LinkDB
Position
Un
AA seq 159 aa
MVSSAGETAVVALGILLAVCHALENTTSALSGPPVAAAVRSHFNDCPDSHSQFCFHGTCR
FLVQEEKPACVCHSGFVGTRCEHADLLAVVAANQKKQTITALVVVSVVASVILIVACVLI
HCCQIRKHCEWCRAFICRHEKPSGLLKGGTSCCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcagctccgccggggagactgcagtggtcgctctgggtattttactagctgtgtgc
catgccttggagaacacaacatctgccttgagtggtcccccagtggctgccgcagtccga
tcccattttaacgactgtcccgactcccacagtcagttctgcttccacggaacctgcagg
tttctggtgcaagaggagaagccagcatgtgtctgccattctgggttcgtcgggacacga
tgcgaacacgcagacctccttgcagtggtagctgccaatcagaagaaacaaaccatcact
gccttagtggtggtttcagtggtagcgtccgtcatccttattgtggcttgtgtactaata
cactgctgtcagataagaaaacattgtgagtggtgccgagccttcatctgcagacacgag
aagcccagcgggctcctgaaggggggaacttcctgttgccattcagagacagtggtctga

DBGET integrated database retrieval system