KEGG   Chrysemys picta (western painted turtle): 101940446Help
Entry
101940446         CDS       T04662                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04010  MAPK signaling pathway
cpic04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101940446 (CACNA1E)
   04020 Calcium signaling pathway
    101940446 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cpic04040]
    101940446 (CACNA1E)
Ion channels [BR:cpic04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101940446 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 101940446
NCBI-ProteinID: XP_008164802
LinkDB All DBs
Position
8
AA seq 2392 aa AA seqDB search
MQATQSCSLLEPEALGDALVSRTASFDILYEPGSREGEASLGFEGSSTFDLGLSQYIPVS
PDVIKRRRGGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVAGRLGSGDAGSEQN
RIRQGPPAPSGATPGAFKQTKAQRARTMALYNPIPVRQNCFTVNRSLFLFGEDNMVRKYA
KKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIK
IVALGFVFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVS
GIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYTNNSGELEEL
DPPHPCGVQGCPSGYECKEWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDAL
GATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNG
YRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRNRTEAVNRDSSDEHCVDISSVGTPL
ARGSIRSAKVDGASYFRHKERLLRISVRHMVKSQVFYWTVLSLVALNTACVAIVHHNQPP
WLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRP
GTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGM
QLFGGRFNFMDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIY
FIILTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPN
MPSIERDRRRRHHMSMWEPRSSQLRDRRRRHHMSVWEQRTSQLRRHMQMSSQEGLNKDAP
PLINPHASIFRRKMPGENVTLEKSEEDHGGSAEHPQAECLDQPIAGTNSCPSTKEDQKSP
SPRAKRDREQWHQKSCHGNCDLTEQEGGGRGGGGGGAGIEDRARLRQSQRRSRHRRVRTE
GKEPAGALESRSASQEAGLEEANPTEGEQARNEGGKEDTNQEEPLAGEELNRTNEIPAGD
AAFAGAMQEMSPLKVPHELNEEKNTSLTEQDCSGLDTSDQALLGSLQMEMSRAVSRSEPE
LSSVTANTEKATESTTIMIDVQDSTVVQISNKTDGEASPLKEAETKEDEEKEKKKRKKEK
SSETGKAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTN
SDRNKVLRYFDYVFTGVFTFEMIIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFAL
ANTLGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLF
MFIFAVIAVQLFKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNII
WALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFV
ALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPS
FEYTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFR
DTWNIFDFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWT
FVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLASLMLLFRS
ATGEAWQEIMLSCLQGKGCEPDTTATSGQHENEHCGTDLAYVYFVSFIFFCSFLMLNLFV
AVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGK
RCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEI
LAIWPHLSQKMLDVLVPLPKTSDLTVGKIYAAMMIMDYYKQSKAKKQKQQLEEQKNAPMF
QRMEPSSLPPEILSNAKALPYLQQDTLSGLSSRSGYPSLSPLSPQEIFQLACMDSTHGQF
QEQQSLEPEVREFQSVQPSNRGNYLPVDTQERAVSGRASSMPRLTVDPQVVTDTSSMRRS
FSTIRDKRPNSSWLDEFSMERSSENTYKSRRRSYHSSLQLSARRLNADSGHRSETHRSGG
RERGRSKERKHLLSPDISRCNSEERSPQADGESPVRRQSRSPSEGRSQTPNRQGTGSLSE
SSIPSISDTSTPRRGRRQLPPVPPKPRPLLSYASMMRHPGDTSPQPDESEGGSPLFSQAL
ETNDTCLTESSSSPQGKQSRHSTPQRYISEPYLALHDDSHASDCGEEETLTFEAAVATSL
GRSNTIGSAPPLRHGWQMPNGHYRRRRRGAAQGVMCGASIDVLSDTEEDDKC
NT seq 7179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccacccagtcctgcagcctgctggagcccgaggccttgggggacgctctggtc
tcacgcacggccagctttgacatcctctatgagccagggtcccgggagggggaggccagc
ttgggctttgaggggagcagtacttttgacctgggactgagccagtacatcccagtgagc
ccagacgtgattaagcgccggaggggcgggctgatcgaacagcgggacatcatcaaggcg
cacgaggctcacaagatgcaaagcacgccgcaggcgaggcggaaggagtgggagatggct
cgctttggggaggcggtggctggccgcctgggatccggagatgcgggctctgaacagaac
aggatccgccaaggaccccccgcgccttccggagcgaccccgggagccttcaagcaaacc
aaagcgcagagggccaggactatggctctgtacaaccccatcccagtccgacagaactgc
ttcacagtcaacagatccctcttcctctttggggaagataacatggtcaggaaatacgcc
aagaagctcatcgactggccgccgtttgaatacatgatcctggccaccatcattgcaaac
tgcatcgtcctagcgctggagcagcacctccccgaggatgacaagacacccatgtcccga
cgactagagaagacagagccttacttcattgggatcttttgctttgaagctgggattaaa
atagttgctctgggatttgttttccacaagggctcatacctccggaacggctggaacgtc
atggacttcatcgtggtcctcagtggcatcctcgccacggctggaactcacttcaacacc
catgtggacctgcggaccctgagggcggtgcgtgtgctcaggcctctgaagctcgtctca
ggcattcccagcttacagatcgtgttgaagtccatcatgaaggccatggtgccccttctc
caaataggcctcctgctctttttcgctattctgatgttcgccatcatcggcctggagttc
tacagcgggaaactgcaccgagcttgctacacgaataattcaggtgaactggaagaactg
gatcccccacatccatgtggggtgcagggatgcccctctggttacgagtgcaaggagtgg
attggtcccaacgacgggatcactcagtttgacaacatcctctttgctgtgttgaccgtc
ttccagtgcattaccatggaagggtggaccacagtgctgtacaataccaatgatgcctta
ggagccacctggaactggctgtacttcatccccctcatcatcatcggctccttctttgtt
cttaaccttgtcctgggagtgctttccggggaatttgccaaagagcgagagcgggtggag
aaccgcagagccttcatgaagctgcgtcgccagcagcagatcgaacgggaattgaatggc
tatagggcgtggatagacaaagcagaagaagtaatgctggctgaagagaataaaaatgct
gggacatcagccttggaagtgctcaggagagcaaccatcaaaaggaaccggacagaagca
gtgaatcgtgactcgagtgacgaacattgcgtcgatatctcctccgtgggtacccctctt
gctcgtggcagcatcaggagcgctaaagtggatggcgcctcctatttccggcacaaggag
cgacttctgcgcatctccgttcgccatatggtgaaatcccaagtattttattggaccgtc
ttgagcttggtggctctcaacactgcctgcgttgccattgtccatcacaaccagcctccg
tggctcacccacctcctctactatgcagagttcctgttccttgggctcttcctcctggag
atgtccttaaagatgtatggaatggggccgcgcctttactttcattcctctttcaactgc
tttgactgtggggtcacagtgggaagcatctttgaagtggtctgggctatcttcagacca
ggaacctcttttgggatcagcgtcttacgagcccttcgtcttctgagaatatttaaaata
acaaagtattgggcatccctgaggaatttggtggtctccctgatgagttccatgaagtcg
ataatcagcttgctcttcctccttttcctcttcattgttgtcttcgctctcttgggaatg
cagctgtttggaggcagatttaatttcatggatgggactccttctgcaaactttgacacc
ttccctgcagccatcatgacagtgtttcagatcctgacgggcgaggactggaacgaggtg
atgtacaacgggatccgctcccagggcggagtccgctcaggcatgtggtcctccatctac
ttcatcatcctcaccttgtttggaaactacaccctgctgaatgtgttcttggccatcgct
gtggacaacctagccaatgctcaggagctgacaaaggatgagcaggaggaagaggaggct
tttaaccaaaagcatgccctgcagaaagccaaggaagtcagcccgatgtctgctccaaac
atgccctccattgaaagggacagaaggaggagacaccacatgtcgatgtgggagccacgc
agcagccaactgagggacaggagaaggcgacatcacatgtcggtgtgggagcagcgtacc
agtcagctccgcaggcacatgcagatgtccagccaggagggccttaacaaggacgcccct
cccttgatcaaccctcacgccagcatattcaggaggaaaatgcctggggaaaatgtaacc
ctggagaagagtgaagaggatcatggaggcagtgcagagcacccgcaggcagaatgcctg
gaccaacccatcgcaggcaccaactcatgcccaagcaccaaagaggaccagaaaagccca
tctcctcgagccaagagagacagggaacaatggcatcagaaatcatgccatgggaactgt
gatctgactgagcaggaggggggagggagaggaggcggagggggaggcgcagggatcgaa
gaccgagcacggttgaggcagagccagaggcgcagccggcaccggagagtgcgaactgag
gggaaggagccggctggggccctggagagcaggtcagccagccaagaggccggcctggag
gaagccaatcccacggaaggagagcaggccagaaatgaaggggggaaggaggacacgaat
caggaggagccactggcgggcgaggagctgaacagaaccaatgaaatcccagccggtgat
gctgcctttgctggggctatgcaggaaatgagccccctcaaagtcccccatgagctcaac
gaggagaagaacactagcttgacagagcaggactgcagcggcctggacaccagtgaccaa
gccctgctgggcagcttgcagatggagatgagcagagccgtcagcaggagcgaacccgaa
ctgtcctccgtcacggccaacacggagaaagccactgagagcaccaccatcatgattgat
gtccaagactccactgtggtacagattagcaacaagacggatggagaagccagcccctta
aaggaggcagagacaaaagaggatgaggagaaagagaagaagaaacggaagaaggagaaa
agctcagagacgggcaaagcaatggtgcctcatagctccatgtttatcttcagcacgaca
aacccagtgcgaagggcctgccattacatcgtgaacctgcgctacttcgagatgtgcatc
ctcctggtgattgccgcgagcagcattgccctggcagcagaggaccctgtcctgaccaac
tcggacaggaataaagtcctgaggtattttgactacgttttcacgggtgtcttcaccttt
gagatgattataaagatgatagaccagggcttgatcctgcaggacggctcttatttccga
gacctctggaatatcctggatttcatcgtggtagttggggcactggtggcttttgccttg
gcgaatacattggggaccaacaaaggccgggatatcaaaaccattaagtctctgcgtgtg
ctccgggtcttgaggcctctgaagaccattaaacgattgcccaaactcaaggctgtcttt
gactgtgtagtgacttccctgaagaatgtcttcaacatacttatcgtctacaagctcttc
atgttcatcttcgcagtcattgctgtccagctcttcaagggcaaatttttctactgtacg
gacagctctaaggacacagagaaggattgcataggcaactacgtggaccatgagaaaaac
aagatggaggtgaagtgtcgtgaatggaagcgccatgaatttcactatgacaacatcatt
tgggctttgcttacgctcttcactgtctccactggagaggggtggccacaggtgctgcag
cattcagtggatgtgactgaggaggaccgggggcccagccgcagtaaccgcatggagatg
tccattttttacgtggtatattttgtggtcttccctttcttctttgtcaacatctttgtg
gctctcatcatcatcactttccaggagcaaggagacaaaatgatggaggagtgcagtctg
gagaagaacgagagggcctgcattgactttgccattagtgccaaacctcttacgcgctac
atgcctcaaaaccgacacaccttccagtaccgcgtctggcactttgtggtttccccatcc
tttgagtacaccatcatggccatgatagcactgaataccgtggtgctgatgatgaagtac
tattccgcgccttacacatatgagctggctcttaagtacttgaacatcgcatttaccatg
gtattctcattggaatgcgtcctgaagatcatagcttttggcttcctgaattatttccgg
gacacctggaacatctttgacttcatcaccgtgattggcagcatcacagaaatcatcttg
acagacaccaagctggtgaacaccagcagcttcaacatgagcttcctgaagctgttccgg
gctgctcgcctcatcaaactgctccgccagggctacaccatccgtatcctgctgtggacc
tttgtgcagtccttcaaggccctcccatatgtctgtctcttgatcgctatgcttttcttc
atatatgcaatcattgggatgcaggtttttgggaatatcaaattagatgaagaaagccac
attaaccgtcacaacaacttccgcagcttcctggcctcccttatgctcctttttaggagt
gccacgggtgaggcgtggcaggagatcatgctgtcatgcctgcaaggcaaaggctgtgag
ccagacaccacggcaacgtccggacaacatgagaatgagcactgtggcacggatctggct
tacgtgtactttgtctccttcatcttcttttgctccttcctgatgctcaatctgtttgtg
gctgtcatcatggacaattttgaatacctgactcgggattcctccatcctggggcctcat
cacttagatgagtttgtccggatctgggcggaatatgacagagctgcgtgtggccgcatc
cattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaag
agatgtccctccaaagtggcctataagaggctggtgctgatgaacatgcctgtggccgag
gacatgacggtccatttcacctctaccttgatggctctgatccgtacggcgctggacatc
aaaattgctaaaggcggtgcagactggcagcagttggattcggagctgcaaaaggagatt
ctggccatctggcctcacctgtcccagaagatgctggacgtactagtgcccctgccaaaa
acttctgacctgacggtaggcaaaatatatgcagccatgatgatcatggactactataag
cagagcaaagcaaagaagcagaaacagcagctggaggaacagaaaaatgcccctatgttc
cagcgcatggagccctcatctctgcctccagagatcctttctaatgccaaagctttgcct
tacctccagcaggacaccctttcaggcctgagcagccggagtgggtacccatcgctgagt
ccactctctcctcaagagatattccaactggcttgtatggattcaacacatgggcagttc
caggagcagcaatctctggagccagaggttagagagtttcaaagcgtgcagccctctaac
cgtggcaactatctccccgtggacactcaggagcgcgctgtatctgggagggcctcctcc
atgccacgcctgactgtggatccccaggtggttacagacacgagctctatgagacgatca
ttctccaccatccgggacaagcgtcctaacagctcctggctggatgagttctccatggag
cgaagcagtgaaaacacatacaagtcgcgccggcgcagttaccactcctcgctgcagctg
tctgctcgccgcctgaatgcagactcaggccacagatctgagacacatcgctcaggcgga
agagaacgagggcgatccaaagaacgcaagcacctgctgtccccggacatctcccgctgc
aactcggaggagaggagtccgcaggcagatggcgagtctcctgtccggcgccagtccagg
tcacccagcgagggcaggtcacagacgccaaacaggcagggcacgggctccctgagtgaa
agctccatcccctctatatctgacaccagcaccccgagacgaggtcgccggcaactccct
ccggtccccccgaagccacggccgctcctctcttatgcctccatgatgcggcaccctggt
gacacctccccacaaccggatgagagtgagggggggtcccctctattctcccaggcgctg
gagacgaatgacacctgcctgaccgagtcttccagctctccgcagggaaagcagagccgg
cactccaccccccagcgctacatctcggagccatacctggccctacatgacgactcccat
gcctcagactgcggcgaggaggagacgctcacctttgaggctgctgtcgccaccagcctt
ggccgctccaacaccatcgggtcagcccctcctttgcggcatggctggcagatgcccaat
gggcactacaggagaaggaggagaggggcagcgcagggggtgatgtgtggggctagcatc
gacgtgctaagtgatacggaagaagatgacaagtgctag

DBGET integrated database retrieval system