KEGG   Chrysemys picta (western painted turtle): 101941281Help
Entry
101941281         CDS       T04662                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00590  Arachidonic acid metabolism
cpic01100  Metabolic pathways
cpic04370  VEGF signaling pathway
cpic04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101941281 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101941281 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101941281 (PTGS2)
Enzymes [BR:cpic01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101941281 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 101941281
NCBI-ProteinID: XP_005313923
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MIVPCTLIFGLLAFSQAANPCCSNPCQNRGVCMTTGFDRYECDCTRTGFYGENCTTPEFL
TWVKLSLKPTPNTVHYILTHFKGVWNIINSIPFFRDSIMRYVLTSRSHLIDSPPTYNSQY
GYKNWEAYSNLSFYTRALPPVALDCPTPMGVKGKKELPDSAVVVEKFLLRKKFIPDPQGT
NMMFTFFAQHFTHQFFKTDHHKGPAFTKALGHGVDLNHVYGETLDRQLKLRLLKDGKLKY
QMIDGEMYPPTVKDTQAEMIYPPHVPKHLQFSVGNEVFGLVPGLMMYATIWLREHNRVCD
ILKQVHPEWNDEQLFQTTRLILIGETIKIVVEDYVQQLSGYYFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDSFQIHDQEYTFQQFLYNNSIMVEHGLSHMVKSFSKQIAGRV
AGGKNVPFAVQKVAKASIDQSRQMRYQSLNEYRKRFLMKPFKSFEELTGEKEMAAELEEL
YGDIDAMELYPGLLVERPRPGAIFGETMVELGAPFSLKGLMGNAICSPEYWKPSTFGGKV
GFEIINTASLQKLICNNVKGCPITAFHVLNSEATETATINVSSSSSSMEDINPTLLMKER
SAEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgccttgcactttaatcttcggtctcctggctttcagccaagcagctaatcct
tgctgctcaaacccatgccagaacagaggagtgtgtatgacgacaggttttgaccgatat
gaatgtgactgtacaaggacaggattttatggggaaaactgtactacaccggaattcttg
acctgggtgaaactgtcattgaaacctactccgaacactgtccactacatcctcactcac
ttcaaaggtgtctggaatataataaacagcattcccttcttccgtgattccatcatgaga
tatgtattgacatcaaggtcacatttgattgacagtccaccaacgtacaacagccagtat
ggttacaaaaactgggaagcctattccaacctttccttctacactagagccctcccacca
gtggcactggactgcccaacacccatgggtgttaaaggtaagaaggagctcccagattct
gcagtagttgtggagaaatttctgctgaggaaaaaatttattcctgatcctcaaggcaca
aatatgatgttcacgttctttgctcaacatttcacccaccagttctttaagacagatcac
cacaaagggccagccttcaccaaagctctcggccatggggttgacttgaaccacgtctat
ggagagactttggatagacaacttaagctgaggctacttaaggatggaaagctgaagtat
cagatgattgatggagaaatgtaccctcccactgtgaaggacactcaggcagaaatgatc
tacccacctcatgttcctaagcacctgcaattttctgtaggcaatgaggtgtttggtttg
gtcccaggtttaatgatgtatgccacaatatggctcagagaacacaatcgggtctgtgac
atccttaagcaggtgcatccagaatggaatgatgagcagcttttccaaactaccaggctc
atattgataggagagaccatcaagattgttgttgaagactacgtgcagcagttgagtggc
tactacttcaagctgaagtttgatcccgagttgctgtttaaccagcaatttcaatatcag
aatagaattgcagccgaattcaacactctgtaccactggcacccacttctgcctgacagt
tttcagatccatgaccaggagtacactttccagcaatttctctacaacaactctatcatg
gtggaacatggcctttcccacatggtgaaatccttctccaagcaaattgccggcagggtt
gctgggggtaagaacgttccttttgcagtacagaaagtagctaaggcttcaattgatcaa
agcagacagatgagataccagtccttgaatgagtaccgaaaacgcttcctaatgaaacct
tttaagtcatttgaggaacttacaggagaaaaagaaatggcagctgaattagaagagctt
tatggagacattgatgctatggagctgtaccctggccttctagtagaaaggcctcgtcct
ggtgccatctttggtgagaccatggtggaacttggagcaccattctctttgaaagggctg
atgggaaatgctatctgttctccagagtactggaaaccaagcacctttggcggaaaagtg
ggctttgaaataatcaatactgcctccctacagaagctcatctgcaataacgtgaagggc
tgtcccatcactgccttccatgtcctaaactctgaagccacagaaacggccaccattaac
gtcagttcctcaagctcctcaatggaggatatcaaccccacattgctaatgaaagagaga
tccgctgaattgtag

DBGET integrated database retrieval system