KEGG   Chrysemys picta (western painted turtle): 101941684
Entry
101941684         CDS       T04662                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00220  Arginine biosynthesis
cpic00330  Arginine and proline metabolism
cpic01100  Metabolic pathways
cpic04020  Calcium signaling pathway
cpic04146  Peroxisome
cpic04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101941684 (NOS2)
   00330 Arginine and proline metabolism
    101941684 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101941684 (NOS2)
   04020 Calcium signaling pathway
    101941684 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101941684 (NOS2)
Enzymes [BR:cpic01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101941684 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 101941684
NCBI-ProteinID: XP_008177129
LinkDB
Position
Un
AA seq 1154 aa
MMCPWQFLFRPQTGRNTSPKEDINNNVEKAVLKVHSFMKEEATKLNDPSNKQDEMPRIIT
AGEKPPQNGIQPMSQITGCPRHLKIKNWENGTSFHDTLHQTAKGVLNCKAKACQGALMNP
KGLVKGPRDSPVPPEEILPQAIEFINQYYNSFKEPQPEEHQQRMQSVTEEIETTGTYQLT
KEELIFATKQAWRNAPRCIGRIQWSNLQVFDARNCTTAKEMFEHICRHLEYATNNGNIRS
AITVFPQRTDGKHDFRLWNSQLIRYAGYQMPDGSILGDPATVEFTQLCIELGWKPKYGRF
DVVPLVLQANGQDPEIFELPPELVLEVSMEHPKYEWFKELDLKWYALPAVANMLLEVGGL
EFTACPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLETNKLSSLWKDRAVIEINVAV
LHSFQKQNVTIMDHHSAAESFMKYMQNEYRLRGGCPADWVWLVPPISGSITPVFHQEMLN
YVLTPFYYYQVDAWKTHVWHDEKRRPKKREIKFRVLAKAAFFASTLMRKTMAARTKATVI
YATETGKSETLANNLCALFNCAFNTKVLCMDEYKLSDLEKETLLLVVTSTFGNGDSPGNG
KKLKNALFTLKKMSKKFRYAVFGLGSTMYPEFCAFAHAIDQKLAQLGASPLTQTGEGDEL
NGQEEAFRTWAVNAFKTACETFDIRGKNSIQLPKVYTSNETWNPKNYRIAHDSQPLDLSK
ALGNIHAKDVIPMKLKFRQNLQSLKSSRVTILLKLSCETNQEMHYLPGEHVGIFPGNQPE
LVSGIIEHVKDAPPTDQIIRLETCNDGGYWTSDKKIPPCTLSQALTYFLDITTPPSQHLL
KKLSQLATEEGDKHRLEVLCHSSEEYNKWKFFNSPTILEVLKEFPSTQVSTSFLLTQLPL
LKPRYYSISSSRDMTPKEIHLTVAVVNYRTRDGQGPLHHGVSSTWLNTIDLKETVPCFVR
SASGFQLPKDPAKPCILIGPGTGIAPFRSFWQQRLSDLEKKGIKGSGMTLLFGCRQPDMD
HLYREETQEMKRKGVLKEVYTAYSRQPGQAKVYVQDILQSKLEAEVVQVLHEDEGHLYVC
GDVRMARDVAQTLKEMFTKKLKLTEEQAEDYIFQLKSQKRYHEDIFGAMVPHEGKRNAST
LKPTSPRTTQQLMF
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgatgtgcccttggcagttcctattcaggccccaaacaggtcggaacacatcccccaaa
gaggatataaacaataatgtggaaaaagcagtcctgaaggttcacagcttcatgaaagaa
gaagccacaaagctaaatgatccaagcaacaaacaggatgagatgccgcgcatcataact
gcaggagagaaacctccgcagaatggcatccaacccatgagccaaataactgggtgtccg
agacatttaaaaattaaaaactgggaaaacggaacaagctttcacgacacgttgcaccag
acggcaaagggggttctcaactgcaaggccaaggcctgccagggggccctcatgaacccc
aaaggcttggtgaaaggcccccgagacagtccagtcccaccggaagagattttaccccag
gcgatagaattcatcaatcaatactacaattcatttaaagagccacaaccagaagaacac
cagcagcgaatgcaatcagtaaccgaagagatagaaacaacaggaacctaccagctgaca
aaagaggaactcatttttgcaaccaaacaggcctggagaaatgctccgagatgcatcggg
agaatacaatggtccaacctacaggtgtttgatgcacgtaactgtactacagctaaggaa
atgtttgaacacatctgtcgtcatcttgaatacgccacaaacaatggaaacatcagatcg
gccatcacggtcttccctcagaggactgatgggaaacatgatttccgtttgtggaacagc
caactcatccgatatgctgggtaccaaatgccagatggctccatcttgggagacccagct
actgtggagtttacacagttgtgcatcgagcttgggtggaagcccaaatatggtcgcttt
gatgtcgttccactggttctccaagcaaacggccaagacccggaaatatttgaactgccg
ccagaacttgtccttgaagtgtcaatggaacatccaaagtatgaatggtttaaggagctc
gatttgaagtggtacgcgctgcctgctgtcgccaacatgctgctggaagtggggggcctg
gaatttacagcctgcccttttaacggctggtacatggggacagagataggcgtgcgagac
ttctgtgacgtacagcgctacaatatcctgaaggaagtaggcagaaggatgggtctggaa
accaacaaactttcctcattatggaaagatcgagcggtgatagagattaatgttgctgtg
cttcatagtttccaaaaacagaacgtcaccatcatggatcatcactccgcggcggagtct
ttcatgaaatatatgcagaacgagtaccgccttcgaggagggtgcccagccgactgggtc
tggctcgtgcctccgatatcaggcagcatcaccccagtgtttcaccaggagatgctcaac
tacgtcctcacacctttctactattaccaggtagatgcttggaaaacacatgtctggcac
gatgagaaacgcaggccaaagaaaagggagatcaaatttagagttttggcgaaggctgcg
ttctttgcatctacattgatgcggaaaacgatggcggccaggaccaaggcaaccgtgatc
tatgcaacggagactgggaaatctgaaacactggccaacaacctgtgtgccttgttcaat
tgcgccttcaacaccaaggtcctctgcatggatgaatacaagctcagtgacctggaaaaa
gaaaccctccttctagtcgtgaccagcactttcggaaatggtgactctccaggcaacgga
aagaaattgaagaatgccctgttcactctgaaaaagatgagcaaaaaattcagatatgct
gtatttggcctggggtcaaccatgtatccagagttttgtgccttcgctcatgccattgac
caaaaacttgcacagttaggcgcctctccgctcacccaaacaggtgaaggggacgaactc
aatgggcaggaagaagcctttcgcacctgggcagtgaatgcattcaagactgcctgtgag
acttttgacatccgtggaaaaaatagtattcagttacccaaggtttacacctcaaatgaa
acctggaatcccaagaattacaggatagcacatgactcccagcctttggacttgagtaaa
gcacttggaaacatacacgcaaaagatgtgattcccatgaagctcaagttcaggcagaat
ctgcaaagtttaaaatccagtcgtgttaccatcctacttaagctttcctgtgagactaat
caggaaatgcactatctgcctggagaacatgttgggattttcccaggcaaccagccagaa
ttagtcagtggcatcattgagcacgttaaggatgcaccaccaactgatcagatcatcaga
ctggaaacctgcaatgatggtggctactggaccagtgacaagaaaattccgccctgcaca
ctttcccaagccctgacgtatttcctggatatcactacaccaccctcccaacatctgcta
aaaaaactctcccagctggcaacagaggaaggagacaaacacagactggaagtcttatgt
catagttcagaggagtacaacaagtggaagtttttcaacagccccaccattttggaggta
ctgaaagagtttccctccacccaagtctccacgtcttttttactaacgcagctgcctctg
ctgaaaccccggtactattccattagctcttcacgggacatgacgcccaaagagatccat
ttgacagttgcagtggtcaactacaggacaagggatggccaaggtcctttgcaccatggt
gtgagcagcacatggctgaatacgatagatcttaaggagacggtcccatgctttgtgcgc
agtgctagcggattccagcttccgaaggaccccgccaagccctgcattctgattggcccg
ggaacaggaatcgctccattcagaagtttctggcaacagcgcctctctgacttagaaaag
aaaggaattaaaggcagcggcatgacattgttgtttggctgccggcagccagacatggat
catctctacagagaagaaactcaagaaatgaaaagaaaaggagtgctgaaagaggtctat
acagcctactcacggcaacccggccaagctaaagtctacgttcaagacattcttcaaagc
aagctggaggcagaagtcgtacaagtcttacatgaagatgaaggtcatttgtatgtctgc
ggggacgtgcgcatggccagggacgtcgcccagaccttgaaagagatgttcacaaagaaa
ctgaagctgacagaggaacaggctgaagactatatcttccagctgaagagccaaaagcga
taccatgaggacatatttggggctatggttccacatgagggcaagagaaatgcaagcact
ttgaaacccaccagcccaagaaccactcaacagttaatgttttag

DBGET integrated database retrieval system