KEGG   Chrysemys picta (western painted turtle): 101942371Help
Entry
101942371         CDS       T04662                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101942371
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cpic01002]
    101942371
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpic04147]
    101942371
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101942371
Peptidases [BR:cpic01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101942371
Exosome [BR:cpic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101942371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Pico_P2A
Motif
Other DBs
NCBI-GeneID: 101942371
NCBI-ProteinID: XP_008165574
LinkDB All DBs
Position
24
AA seq 295 aa AA seqDB search
MPNESNGPDPNARRSVVDDDNEELKTLMSSLSASLLGCYRSSSDSSDGQNSLQRIIGGYI
VAPHSSKYLVSLKRKTGFHFCGGSLVSRSWVLTAAHCKTEPGPLLSPNRINQMMIVAGEY
SLSTFEGTEQIFRPSRMVVHPDYSSASKNADIMLIKLNRPLVHNAFVSIVPLPQQGAVVR
EGRFCQVSGWGYTTPMGGMASDTLRSVRLPIISSGKCNSTASYAGYITKNMICAGFNTGG
KDACQGDSGGPLVCEGRVFGIVSWGNSCASPRYPGVYTAVANFQKWIYKTIFRRQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatgagtccaatggtccagacccaaatgcccgaaggtcggtggtagatgatgac
aatgaagagctgaagacactgatgagcagcttgtccgcatcgcttctgggctgctaccgc
tccagctccgacagctcagatggccagaacagcctccagcgcatcatcgggggttacata
gtggcgccacattcctccaagtacctggtgtccctgaagaggaagacgggcttccatttc
tgtggcgggtcgctggtcagccgaagctgggtcctgacggctgctcactgcaaaactgaa
ccaggccctctgctgtctcccaacagaattaaccagatgatgattgtcgctggggaatat
tctctctccacttttgaaggcacagagcagatcttccggccctctcggatggtggttcat
ccggactacagctccgcttccaaaaatgcagacatcatgctgattaagctgaacaggccg
ctggtgcataacgcttttgtttccattgtgccactcccccagcaaggagcggtggtgagg
gaaggccgcttctgccaagtctctggctggggttacaccactcccatgggtggaatggct
tcggacaccctacgcagcgtgcgcctgcctatcatctcttctgggaagtgtaacagcaca
gcctcctatgcgggatacatcaccaagaacatgatctgtgccgggttcaacacagggggc
aaagatgcctgccagggggactctggcgggccattggtgtgcgagggccgagtgtttggg
attgtgtcctgggggaacagctgtgctagtcccaggtacccaggtgtttacaccgcagta
gccaactttcagaaatggatttacaaaaccatctttaggcgccaatag

DBGET integrated database retrieval system