KEGG   Chrysemys picta (western painted turtle): 101942490
Entry
101942490         CDS       T04662                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04010  MAPK signaling pathway
cpic04210  Apoptosis
cpic04620  Toll-like receptor signaling pathway
cpic04621  NOD-like receptor signaling pathway
cpic04622  RIG-I-like receptor signaling pathway
cpic04623  Cytosolic DNA-sensing pathway
cpic04625  C-type lectin receptor signaling pathway
cpic04920  Adipocytokine signaling pathway
cpic05132  Salmonella infection
cpic05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101942490 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101942490 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101942490 (IKBKG)
   04621 NOD-like receptor signaling pathway
    101942490 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    101942490 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    101942490 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    101942490 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101942490 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101942490 (IKBKG)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101942490 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101942490 (IKBKG)
Protein kinases [BR:cpic01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101942490 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 NEMO Bacillus_HBL zf_C2H2_ZHX AAA_31
Other DBs
NCBI-GeneID: 101942490
NCBI-ProteinID: XP_005280197
LinkDB
Position
Un
AA seq 522 aa
MDGVGEPAIRQSNQMLRQRYQEFLRFKVAQRKEKDFLMLRFQEARDVVEKLNAERTEMKC
QLEQALWEVEQLKGRQQLSALEKEIPEPEEADTMTLTQELAEPMMAPGPETLQLLKEQLE
QLQEANRALQAQIQQQVQPPGEAGVRVKENGVQLERPVELEALQGGGDSGRRDAAELLQR
RLKETEEESVGLKQQLALVREEMAKLGARAQEAEQQAEQQLQALRKQLEQLTEDRASVKA
QVTSLLGELQESQSRLEACMLEKRDLEEKAQAAAERCCKLEREAEALHKQHSVQMDQLRM
QAQNLETALRVERQGATEEKRKLAQLQAAYHQLFQDYDGHVKSGLESEKKSQGMELHLEE
LQQQLQQAEEALVAKQELIDKLKEDMEQHKAVLETIPVLKAQADIYKADFLAEREAREKL
HEQREDLKEQFEQLRRDYDKLMIDANGATWTLMEEMRNRHSEGRPPVPQPVYNMAPVPFQ
PLPAAGRRRSIHEEQPDFCCPKCQYQAPDMDTLQIHVMDCIK
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggatggggttggagagccggccattcggcagagtaaccagatgctgcggcagcgctac
caggagttcctgcgcttcaaggttgctcagcgcaaggagaaggacttcctgatgctccgt
ttccaggaggcccgggatgtggtggagaagctgaacgctgagcggaccgagatgaagtgt
caactggagcaggccctctgggaggtggagcagctcaagggaaggcagcagctgagcgcc
ttggagaaggagatccctgagccagaggaggcggacactatgaccctgacccaggagttg
gctgagcccatgatggcccctggcccggagaccctgcagctgctgaaggagcagctggag
cagctccaggaggccaaccgggctctgcaggctcagatccagcagcaggtgcagccccca
ggagaggctggtgtgagggtcaaggagaatggggtccagctggagaggccggtggagctg
gaggccctgcagggcggcggggacagcggcaggcgggacgcagccgagctgctgcagagg
aggctgaaggagacggaggaggagagcgtggggctgaagcagcagctggcattggtgcgg
gaggagatggccaagctgggagccagggcacaggaggctgagcagcaggccgagcagcag
cttcaggccctgaggaaacagctggagcagctgactgaggacagggcctcggtgaaagcc
caggtgacctcactgctgggggagttgcaggagagccagagccggctggaggcctgtatg
ctggagaagcgggatctggaggagaaagcacaggctgctgccgagcggtgctgcaagctg
gagcgggaggccgaggcgctgcacaagcagcacagcgtgcagatggaccagctgcgcatg
caggcccagaacctggagacggcgctgcgggtggagagacagggcgccacagaggagaag
aggaagctggcccagctgcaggcagcctatcaccagctctttcaggattacgatgggcac
gtgaaatctggcctagagagcgagaagaagagccagggcatggagctgcacctggaggag
ctgcagcagcagctgcagcaggctgaggaggcactggtggccaagcaggagctgattgac
aagctgaaggaggacatggagcagcacaaggctgtgctagagaccatcccggtgctgaag
gcccaggctgatatctacaaggcggatttcctagcggagcgtgaggcccgggagaagctg
cacgagcagcgcgaggatctgaaggagcagtttgagcagctacggcgggactacgacaag
ctgatgatagatgctaatggagccacctggactctgatggaggagatgaggaaccgccat
tcggaggggcgcccacctgtaccccagccagtttacaacatggccccagtacctttccaa
cccctgccagctgcagggcgcaggcgaagtatccacgaggagcagccggatttctgctgt
cccaagtgccagtaccaagctccggacatggatacactgcagatccatgtgatggactgt
atcaagtga

DBGET integrated database retrieval system