KEGG   Chrysemys picta (western painted turtle): 101943518Help
Entry
101943518         CDS       T04662                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cpic01002]
    101943518 (TMPRSS2)
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101943518 (TMPRSS2)
Peptidases [BR:cpic01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101943518 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2
Motif
Other DBs
NCBI-GeneID: 101943518
NCBI-ProteinID: XP_008178092
LinkDB All DBs
Position
Un
AA seq 504 aa AA seqDB search
MQLSYHFSGGWINYSNGNPPSLPPYYENHGYQPENVYISRQPEDANVYPQYPPPYYPPSV
PHYVPRVPVHQSAPPVVQPKPPSAKMCTPEVKKALCIILSVAIILSGAIIAAILIWYFVA
NSCLGSSIECGSSGTCVSPSQWCDGVAHCSNGEDENRCVRLYGPNFILEVYSSISKSWYP
VCKDDWNENYGKIACKDMGYNVNTYYSSQGITPERGFTSFMRLNTSAGNIDLYKKLYNSD
SCVSGAVVSLRCTKCGVSRKNSNPASRIVGGSAAVLRDWPWQVSLQVQGSHVCGGSIITP
EWIVTAAHCVEGQFSSPNYWNVYAGILKQTETRYRSGSRVQKIISHPNYDSDTKDNDVAL
MKLQTPLSITDTVAPVCLPNPGMMFQPDQQCWISGWGAEYQGGKTSDVLNAVMVPLIERS
VCNSAKFYNGLVLPTMICAGYIEGGKDSCQGDSGGPLVTEKNSVWWLVGDTSWGTGCASR
RRPGVYGNMTMFTDWIYRNMQANR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttagctaccacttctcaggggggtggattaactacagcaatggaaacccccct
tctctaccaccatactatgaaaatcatggttatcagccagaaaacgtctatatttccaga
cagcctgaggatgctaatgtgtatccacagtaccctcctccatattatcctccgtcagtg
ccacattatgtcccaagagttcctgttcatcagtcagctcccccagtagtacagccaaag
cctccatcagcgaaaatgtgcacaccagaagttaagaaagctctatgcatcattttatct
gttgcaataatactatcgggtgccataattgcagctatccttatctggtattttgtggcc
aatagctgtcttggctcatcaatagagtgtggatcttcaggaacatgtgtctcaccatct
cagtggtgcgatggagtggcccactgttccaatggtgaagatgaaaaccgatgtgttaga
ctctatggaccaaattttatcctagaggtctattcatctatcagcaaatcctggtatcca
gtatgcaaagatgactggaatgagaactatggaaagatagcttgtaaagacatgggatac
aatgtaaatacttattactctagtcaaggaataacgcctgaaagaggttttacaagcttt
atgaggttgaatacaagtgctgggaacatagacctatacaaaaaactgtataacagtgac
tcgtgtgtgtctggagcagtggtatctctgcgttgcacaaagtgtggagtatcccgtaaa
aattcgaatcctgccagcagaattgtgggtggcagcgctgcagtgctgagggactggccg
tggcaggtcagccttcaagtccaaggctcccatgtatgtggaggctccattatcacccca
gaatggatagtgacagctgctcactgtgtagaaggacagttttcttctccaaactactgg
aacgtgtatgctgggattctgaagcaaacggaaacgcgctacagaagtggatccagagtg
cagaaaataatttcccacccaaattatgattcagatactaaagacaatgacgttgccctg
atgaagttacagacaccgctgagtattactgacactgtagcacctgtttgtttgcctaac
cctggaatgatgttccaacctgatcaacagtgctggatatctggatggggagcagaatac
caagggggtaaaacttcagatgtcttgaatgccgtaatggtgcctttaatagaacgttct
gtgtgtaattctgccaaattctataatggcttagttttgcctaccatgatatgtgctggg
tatatagaaggaggaaaggattcctgccagggtgacagtggaggtccgttagtaactgag
aaaaactccgtgtggtggctagttggtgacacaagctggggaactggctgtgccagtcgc
agaagacctggagtttatggaaatatgactatgttcaccgactggatttacagaaatatg
caggcaaataggtga

DBGET integrated database retrieval system