KEGG   Chrysemys picta (western painted turtle): 101943798Help
Entry
101943798         CDS       T04662                                 

Definition
(RefSeq) trypsin I-P38-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cpic00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101943798
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101943798
Peptidases [BR:cpic01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101943798
Exosome [BR:cpic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101943798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 101943798
NCBI-ProteinID: XP_005281728
LinkDB All DBs
Position
Un
AA seq 248 aa AA seqDB search
MKYILVVAFLGVAVAFPIDDADDDKIVGGYTCSKNSLPYQASLNIGYHFCGGALINSRWV
VSAAHCYKSSIQVRLGEHNIAVNEGTEQFIASAKVIRHPSYSSQTLNNDIMLIKLSSAAT
LNSYVKTIALPTSCVATGTQCLISGWGNTLSSGTNYPDLLQCLKAPVLSSSQCSSAYPGQ
ITSNMICIGYLEGGKDSCQGDSGGPVVCNGSLQGIVSWGIGCAQRGYPGVYTKVCNYVSW
IQNTIAAN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcctggttgtagcctttctgggagtggctgttgccttccccatcgatgat
gctgatgatgacaagattgtgggaggctacacctgttcaaagaactctttgccctaccag
gcatccctgaacatcgggtaccatttctgcggaggtgccctcattaacagcagatgggtt
gtctcagccgctcactgctacaaatcctctatccaggtgaggcttggagaacacaacatt
gcagtcaatgaaggaactgagcagttcattgcatcagccaaagtcatccgtcaccccagc
tacagctcccagacgctgaacaatgacatcatgctcatcaagctgtccagtgcagcaacc
ctcaactcctacgtcaagacaattgcccttccgaccagctgtgtggccactggcacccag
tgcctgatctctggctggggcaacaccctcagcagtggcactaactaccctgacctcctg
cagtgcctgaaagctcctgtcctgtcctccagccagtgcagcagcgcctatccaggacaa
atcactagcaacatgatctgtatcggatacctggaggggggcaaagattcctgccagggg
gattccggtggcccagtagtctgcaatgggagtctccaggggattgtctcctggggaatt
ggttgtgcacagagaggctaccccggggtctacactaaagtgtgcaactatgtctcctgg
atccaaaataccatcgctgctaactga

DBGET integrated database retrieval system