KEGG   Chrysemys picta (western painted turtle): 101943958
Entry
101943958         CDS       T04662                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04068  FoxO signaling pathway
cpic04110  Cell cycle
cpic04115  p53 signaling pathway
cpic04218  Cellular senescence
cpic04310  Wnt signaling pathway
cpic04340  Hedgehog signaling pathway
cpic04371  Apelin signaling pathway
cpic04510  Focal adhesion
cpic04530  Tight junction
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101943958 (CCND1)
   04340 Hedgehog signaling pathway
    101943958 (CCND1)
   04371 Apelin signaling pathway
    101943958 (CCND1)
   04068 FoxO signaling pathway
    101943958 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101943958 (CCND1)
   04115 p53 signaling pathway
    101943958 (CCND1)
   04218 Cellular senescence
    101943958 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101943958 (CCND1)
   04530 Tight junction
    101943958 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101943958
NCBI-ProteinID: XP_005278786
LinkDB
Position
4
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKNRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELFLVNKLKWNLAAMTPHDFIEHFLTKMPVAEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNISSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgttgtgaagtggaaaccatcagaagagcctatctagatgcc
aacctactaaatgacagggttctgcagacaatgctgaaggcagaggagacctgctcgccc
tctgtgtcctacttcaagtgcgtgcagaaggaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaaatgtgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgtttgaacccctcaagaaaaaccgattgcaa
cttctgggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctaacc
gcagaaaaactgtgcatttacaccgataactccattagacccgacgaattactgcaaatg
gagctgtttctggtgaataagctgaaatggaatctggccgcaatgacccctcatgatttc
attgaacatttccttactaaaatgcctgtggctgaggacaccaagcaaatcatccgtaaa
catgcccagacttttgtggctctgtgcgctacagatgttaagtttatttcaaacccacct
tccatgatcgcagctgggagtgtggtagcagctgtgcaaggccttcacctgggaaacact
aacactttcctctcctatcaatgtctcacacatttcctatcacaagttatcaaatgtgac
ccggattgtttacgagcttgccaagaacagattgaatccctcctcgaatccagtctacgc
caggcacagcaacacaacatatcttcagaaacaaagactgttgaggatgaagcagacctt
tcctgcacacccactgatgtgcgagacgtgaacatttaa

DBGET integrated database retrieval system