KEGG   Chrysemys picta (western painted turtle): 101944327Help
Entry
101944327         CDS       T04662                                 

Definition
(RefSeq) anionic trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101944327
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cpic01002]
    101944327
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpic04147]
    101944327
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101944327
Peptidases [BR:cpic01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101944327
Exosome [BR:cpic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101944327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 101944327
NCBI-ProteinID: XP_005281729
LinkDB All DBs
Position
Un
AA seq 243 aa AA seqDB search
MKFLLILACLGAAVAVPVDDDDKIVGGYTCSVPYQVSLNSGYHFCGGSLINNQWVVSAAH
CYKSRIQVRLGEYNIDVLEGDEQFINSAKVIRHPKYNSWLLDNDIMLIKLATPAALNSRV
TAISLPSACVAAGTTCLISGWGNTLSSGSNYPELLQCLDAPVLTDAECSGAYPGQTTTNM
ICVGFLEGGKDSCQGDSGGPVVCGGELQGIVSWGIGCAMQGYPGVYTKVCNYVDWIEETI
AAN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttctcctgattcttgcctgcttaggagcagcagttgctgtccctgttgatgat
gatgacaaaatcgtggggggctatacctgctctgtcccctaccaagtgtccctgaactct
gggtaccacttctgcgggggctctctcatcaacaaccaatgggtcgtgtcagctgctcac
tgctacaaatcccgcatccaggtgaggctcggggaatacaacatcgatgtgttggaaggg
gacgagcagttcatcaactccgctaaagtaatccgccaccccaaatacaattcgtggctc
ctggataatgacattatgctgatcaagctggcaaccccagctgccttgaactcccgtgtc
acagcaatctctcttccttctgcctgtgtggctgctgggactacgtgtttgatttctggg
tggggaaacaccctcagcagtggctctaactaccccgagcttctccaatgtctggatgct
ccagtcctgactgacgctgagtgcagtggtgcttacccaggacaaaccactacaaacatg
atctgcgtgggattcctggagggtggcaaagactcctgccagggcgattctggtggccca
gtcgtgtgtggtggtgagctccaaggaattgtgtcctgggggatcgggtgtgctatgcag
ggttaccctggagtctacaccaaagtctgcaactatgttgactggatcgaggagaccatt
gctgccaactga

DBGET integrated database retrieval system