KEGG   Chrysemys picta (western painted turtle): 101945048Help
Entry
101945048         CDS       T04662                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00052  Galactose metabolism
cpic00500  Starch and sucrose metabolism
cpic01100  Metabolic pathways
cpic04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101945048 (GAA)
   00500 Starch and sucrose metabolism
    101945048 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101945048 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpic04147]
    101945048 (GAA)
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101945048 (GAA)
Exosome [BR:cpic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101945048 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 101945048
NCBI-ProteinID: XP_005283057
LinkDB All DBs
Position
Un
AA seq 949 aa AA seqDB search
MPPMRLKQAENFPGCQKASCTVLQVSVISIAALLATVALHTIFNVHEVIVAAASLGDPPG
PETTHRSGSANGEGRTWYRRWAGHLESPGAAASGPLRCDRSPDSRFDCAPEKLLSRAECE
ARGCCYVPVSSRGPAIWQPWCFFPTSYPSYKVENLSATQTGYTARLTRTVPTFFPEDIMV
LRLDVVFETEGRLHFTLRDPANKRYEVPLETPKARGQIASKLYRVQFSADPFGLMVFRES
SGQVLLNTTVAPLFFADQFLQISTSLPSHFISGLGEHLTSLALNVNWTKVTLWNRDMAPT
PYVNLYGSHPFYLVMEDGGLAHGVFLLNSNAMDVVLQPSPALTWRTTGGILDFYVFLGPD
PKSVVRQYLDVIGSPFMPPYWGLGFHLCRWGYSSTAATRQAVKNMTAARFPLDVQWNDLD
YTDAKRDFTFNKNNFKDYPDMVREFHRSGRKYVMIVDPAISSSGPPGSYKPYDDGLKRGV
FIRNATGQPLVGKVWPGPTVFPDFTNPETQRWWHDMVQEFHDQVPFDGMWIDMNEPSNFV
AGSLDGCPNNKLENPPYVPGVLGGSLRAGTICASSQQYLSSHYNLHSLYGLTEAVASHDA
LVRVRGKRPFVISRSTFAGHGRFAGHWTGDVRSSWEQLYYSIPEVLLFNLYGVPLVGADI
CGFLGDTSEELCVRWTQLGAFYPFMRNHNDHGSKPQEPYAFSPAAQEAMRKALVLRYSLL
PYLYTLFHKAHSAGETVARPLFLEFPTDPNTLSVDRQFMWGAGLLITPVLEAGKTNVSGY
FPLETWYNLMAGSVIHSKGQWVLLPAPLDTINVHVRAGHILPLQEPGLTTTESRKKGMAL
VVALTVAGVARGDLFWDDGESLLTFEKGDYTQILFLATNGALLSELVRVNSQVDGLLLQE
VTVLGVPGPPQRVLANGIPVSDFSYNADTKILVIPLSLPMGEQFMVTWS
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaatgagactgaagcaggcagagaatttccccggctgccagaaggcttcctgc
accgtgctgcaggtgtctgtcatcagtattgctgctctgctcgcaacagttgccctacac
accatcttcaatgtccatgaagtcattgtggctgccgcgagcctcggagaccccccgggg
ccagagacaacccaccgatccggtagcgctaatggagaagggcggacgtggtatcggagg
tgggcagggcacctggagagcccaggtgctgctgcgtcagggcccttgcgctgtgaccgc
tctccagacagccggtttgactgtgcacctgagaagcttctctccagagcagagtgtgag
gctcgtggctgctgctacgtcccggtttcctctaggggccctgcgatttggcagccctgg
tgtttcttcccaaccagctaccccagttacaaggtggagaacctgagtgccacccagaca
ggttacactgcccgcctgacccgcactgtgcccaccttcttcccagaagacataatggtt
ctgcggctggatgtggtgtttgagacggagggcaggctccacttcacgctcagggatcca
gcaaacaaacgctatgaagtgccacttgaaaccccaaaagcgagaggccaaatcgcctct
aaactgtaccgcgtgcagttctcagctgacccctttggcctgatggtattcagggaatcc
agcgggcaggttctgttgaacaccacagttgctccccttttctttgctgaccagttcctc
cagatctccacctccctgccttcccatttcatctctggcttgggggagcacctgacctca
ctcgccctcaacgtcaattggaccaaagtcaccctttggaatcgggacatggcgcccacg
ccttacgtcaatctctatggctctcacccgttctacctggtgatggaggatggcggcttg
gcccatggagtcttcctgctgaacagcaacgccatggatgtggtgctgcagccgagcccg
gccctgacgtggagaacaacgggcggcattctggatttctacgtcttcctgggccctgac
cccaagagtgtggtccggcagtacctggatgtcatcgggtccccgttcatgcccccctac
tggggcctgggattccacttgtgccgctggggctactcctccaccgctgcgacccggcag
gctgtgaagaacatgacagcagcacggttccccttggatgtgcaatggaacgacctagat
tatacagacgccaagagagacttcaccttcaacaagaacaacttcaaggactatccggac
atggtgcgggagttccaccgaagcggccggaagtacgtcatgatcgtggatccagcaatc
agcagctcggggccccccggcagctacaaaccctacgacgatgggctgaagcgaggggtg
ttcatccgaaatgcgacagggcagcctctggttgggaaagtatggcctggcccgaccgtc
ttcccagacttcactaacccagagactcagcggtggtggcacgacatggtgcaggagttc
catgaccaggtgcccttcgacggcatgtggattgacatgaacgagccatccaacttcgtg
gcgggctccttggacggctgcccaaacaacaaactggaaaacccaccctatgtgccaggt
gtcctggggggcagcctgcgggcagggaccatctgtgcctccagccagcagtacctgtcc
tcgcactacaacctccacagtctgtacgggctgacggaggccgtcgcttcccacgatgcg
ctggtgagggtgcgagggaagcgtcctttcgtgatctcgcggtcaacctttgcgggtcac
ggccgcttcgctggccactggactggggacgtccggagcagctgggagcagctgtattac
tctatcccagaggtgctgctcttcaacctgtacggggtgccgctggtcggggcggacatc
tgcggctttctgggtgacacctctgaggagctgtgcgtacgctggacccagctgggcgcc
ttctatcccttcatgcggaaccacaacgaccacggcagcaagccccaggagccgtacgcc
ttcagccctgcagcccaggaggccatgaggaaggccctcgtcctgcgatactcgctgctg
ccgtatctctacaccctcttccacaaggcccactctgcgggggagacggtagcacgaccc
ctcttcctggagtttcccacagacccgaacaccctgagtgttgaccgccagttcatgtgg
ggagcagggctcctcatcacgccagtgctagaggcagggaagaccaatgtcagcggctac
ttccccctagagacttggtataacctgatggcaggctctgtcatccacagcaagggccaa
tgggtccttttaccagctccactggacaccattaatgtccatgtgcgggcaggacacatc
ctacctctgcaagagcctggcctcacgaccaccgagagccggaagaagggcatggccctg
gtagtggccctgaccgtggctggggttgccagaggcgacctgttctgggatgacggtgag
agcctgctgacgtttgagaagggcgactacactcaaatcctcttcctggccacgaacggt
gcgctgctgagtgagctggtgcgggtgaacagccaggtggacgggttgttgctgcaggag
gtgaccgtgctgggtgtccccggcccgccccagagggttctagctaacggcatccctgtc
tccgatttctcctacaacgcagacaccaagatcctggttatcccgctctctctgccaatg
ggggagcagttcatggtcacctggtcctga

DBGET integrated database retrieval system