KEGG   Chrysemys picta (western painted turtle): 101945875Help
Entry
101945875         CDS       T04662                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101945875 (SUV39H2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cpic03036]
    101945875 (SUV39H2)
Enzymes [BR:cpic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101945875 (SUV39H2)
Chromosome and associated proteins [BR:cpic03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101945875 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101945875 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 101945875
NCBI-ProteinID: XP_005304542
LinkDB All DBs
Position
Un
AA seq 363 aa AA seqDB search
MQPPARWRAGEEGTEYFLVKWKGWPESSNTWVALKNLKCPLLLQYFHSDKNEYLSQLKRG
KAVILKNHIKALNPVVAQYVVKKAKQRIALQRWKEELNRKKNHKGMILVENTVDLEGPPL
DFYYINEYKPAPGINVMNGITTGCECSDCPAEKCCPEEAGFFLAYNKQKQLKIQPGLPIY
ECNSYCRCGPECPNRIVQKGTPYSLCIFRTNNGRGWGVKTLQKIKTKRFVMEYVGEVITS
EEAERRGQLYDNQGNTYLFDLDYDSDEYTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNL
DLRLPRIALFSTRTIKAGEELTFDYQMKGSLDVTSDSDAVSPTRKRIRTVCKCGAMCCRG
YLN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccctgcaagatggcgggcaggcgaggagggcacagagtacttccttgtgaaa
tggaaaggatggccagaatcctcaaatacctgggtagctttgaaaaatcttaaatgccca
ttgctccttcagtacttccatagcgacaagaatgaatatttatctcagctaaagcgaggc
aaagcagtaatattgaaaaaccacattaaagctttgaaccctgtagtagcacagtatgta
gtaaagaaggctaaacaaagaatagctctacagagatggaaggaagaactcaaccggaaa
aagaaccataaaggaatgattcttgtagaaaacactgtggatcttgagggccctccttta
gacttttactacattaatgaatataaacctgctccaggaataaatgtaatgaatggaatc
acaaccggctgtgaatgctctgattgccctgctgagaagtgttgtccagaagaggctgga
tttttcttggcttacaataaacaaaagcagttaaaaatccaaccaggcttgcctatctat
gaatgcaactcgtactgtagatgtggtcctgaatgccctaacaggatagtacagaaaggc
acaccatattctctttgcatcttcagaactaacaatggacgtggctggggagtaaaaacc
ctccagaaaattaaaaccaagagatttgtgatggagtatgttggagaggtgatcacaagt
gaggaagcagagagacgaggtcaactgtatgacaaccaaggaaatacatacttgtttgac
ttggactatgactcggatgaatatacggtggatgcagctcgatatggaaatgtgtcccat
tttgtgaatcacagctgtgatccaaatcttcaggtcttcaatgttttcattgataacctt
gatctacgtcttcctcggatagcactgttttctacgagaaccatcaaggctggagaagag
ctcacctttgattatcagatgaaaggttctcttgatgtgacttcagactctgatgctgtc
agcccaacgagaaagaggatcagaactgtgtgcaagtgtggagctatgtgttgcagaggg
tatctcaactga

DBGET integrated database retrieval system