KEGG   Chrysemys picta (western painted turtle): 101946232Help
Entry
101946232         CDS       T04662                                 

Gene name
JAK3
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101946232 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101946232 (JAK3)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101946232 (JAK3)
Protein kinases [BR:cpic01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   101946232 (JAK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 Kinase-like RIO1 APH Haspin_kinase YcbB FERM_M
Motif
Other DBs
NCBI-GeneID: 101946232
NCBI-ProteinID: XP_005278983
LinkDB All DBs
Position
Un
AA seq 1154 aa AA seqDB search
MPSSLSRPREREPSPLAPCPAGEGRAAPAETSPRMRLPPTMAPLGEETPLIGNRSCSLSS
MESGTLQVYLYHPANTPRSDPDLGGVLTFTYGEYLAEELCVAAAKACGILPVCHSLFALA
TEDLKCWFPPNHLFTVDNSSCQVVVYRIRFFFPNWFGPGKSYRFGLLNDRASAVLDCPTI
NYLFAQSRSDFISGRMEGALSLQLQEECLSLAVLDMLRMVKERKWSLEEIFSSVSYKSCI
PETLRHQIQQQSFLTRKRIRRKFHKSLRRISGCQTDDCALKLKYLIDLEKLERTWVEESF
PVRAPSGCEPGQEEQRVIHVSGENGIFWSHGGDESRQPFCDFPEIADISIKQASRDSNPV
ENRIVTVTKTDNRILEVEFLTLREALSFVSLIDGYYRLTADAHHYFCKAVAPPRLLENME
NQCHGPIRSEFAVKKLAANNEGDYLLRRSPQDFDSYLLTVCIKTCLGRDYKGCLIQRDKD
GSFSLSGVARRFCSLQELLCTYQNCTLHADGVALRLGTCCPPRPKEKSNLLIVRGSCCQL
PGSPAAPRRSVNQMMFHKIQPENLLMCENLGQGSFTKIYRGIKRDQDDDECHETQVLLKV
MDGSHGNCSESFLEAASTMSQISHKHLVLLYGVSIKENSIMVQEYVKFGALDIYLKKNQA
GGKVTASWKLEVAKQLAYALNFLEDKKIVHGNVSAKKVLLAREGDAVSGSPPFIKLSDPG
VSLTMLAKEMLIDRIPWVAPECIGDPKNLALESDKWSFGATVWEIFSGGTMPTSALEPLS
KLQFYQNSLQLPAPKWTELANLITQCMDYRPSWRPSFRAIIRDLNSLITSDYELLSDLAP
SELPAKDGFWGFITGPVCQDPTIYEERHLKYMCVLGKGNFGSVELCRYDPLDDSTGELVA
VKRLQQSSAEQLQDFEREIAILRALHNDFIVKYRGVCYSLGRRSLRLVMEYLPKGCLREY
LQKNQERLDHKRLLLYAWQICKGMEYLGSQRYVHRDLASRNILVENETHVKIGDFGLAKL
LPQDKEYYVVREPGQSPVFWYAPESLSDNVFSRESDVWSFGVVLYELFTYSNRSQSPSEE
FLRMMGLDKPMPIICHLLELLKDDRRLPAPPGCPAEVHGLMLSCWAFSQSKRPKFSELGP
KLEALRDSRSKVRG
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgcccagctccctgtcccggccccgggagagggaaccgagcccgctggctccttgtccc
gccggcgagggcagagctgcgcccgcagagacgtcaccccgcatgaggctgcctcccacc
atggcccccctcggagaggagacgcccctgatcggaaacaggtcctgcagcctgtcctcc
atggagtcggggaccctccaggtctacctgtaccacccggccaacaccccgcgatcggac
cccgacttgggcggcgtcctgactttcacgtatggcgagtacttggcagaggagctctgt
gtggcggcagccaaggcctgcgggatcctgcccgtttgccactccctcttcgccctggca
acggaagatctgaaatgctggttcccgcccaaccacctcttcacggtggacaattcgagc
tgccaagtcgtcgtctacagaatcagatttttcttccccaactggtttgggccggggaaa
tcgtaccgcttcgggctgctgaacgaccgagccagcgccgtgctagactgtcccaccatc
aattatctcttcgcgcagtcccgcagcgatttcatcagcgggcgcatggagggggcgctg
agcctgcagctgcaggaggagtgtctcagcctggctgtgctggacatgctgaggatggtc
aaggagaggaagtggagcctggaggagatcttcagcagcgtcagctacaaatcctgcatc
ccggagacgctccggcaccagatccagcagcaaagcttcctgacccgcaagcggatccgg
aggaagttccacaagtccctgcggaggatcagcggctgccagaccgacgattgcgccctc
aagctcaagtacctgatcgacctggagaagctggagaggacgtgggtggaggagagcttc
ccggtccgcgcccccagcggctgcgagccgggccaggaggagcagagggtcatccacgtg
tctggggagaacgggatcttctggagccacggcggggacgagagccgccagccgttctgc
gacttccccgaaatcgccgacatcagcatcaagcaagcgagccgggatagcaatcccgtg
gagaaccggatcgtcaccgtcaccaagacagataacaggatcctagaggtggagttcctc
acgctgcgggaagccctgtccttcgtctccctcattgacggctactaccggctgactgca
gatgcccaccattatttctgcaaggcagtggctcccccccggctgctggagaacatggag
aaccagtgtcatggacccatcaggtccgagtttgcagtgaagaagctggcagcgaacaac
gagggagactacctcctccgccgcagcccgcaggactttgacagctacttgctcactgtc
tgcatcaagacgtgcctcggacgggattacaagggttgcctgatccagagggacaaggac
gggagcttctccctctccggagttgccaggcgcttctgcagcctccaggagctgctctgc
acctaccagaactgcaccctgcatgccgacggggtggccctacgcctgggcacgtgctgc
cctccccggcccaaagaaaaatccaacctgctgatcgtgcgaggcagctgctgccagctc
cccggctccccggctgcaccgcgccgcagcgtcaaccagatgatgttccacaagatccaa
ccggagaacctgctgatgtgcgagaacctgggccagggatccttcaccaagatctaccgg
ggcatcaagcgggaccaggacgacgacgagtgccacgagacccaagtcctgctgaaggtg
atggacggcagccacggcaactgttccgagtccttcctcgaggccgccagcaccatgagc
cagatctcccacaagcacctggtcctgctgtacggggtcagcatcaaagaaaacagtatc
atggtgcaggaatacgtcaagttcggcgcgctggacatctacctgaagaagaaccaagcc
gggggcaaggtgacagccagctggaagctggaggtggccaaacaactggcctatgccctc
aactttttggaggataagaagatcgtgcacggcaacgtctctgctaagaaggtcctgctg
gccagggagggggacgccgtcagcggcagcccccctttcataaagctcagcgaccctgga
gtcagcctcaccatgctggccaaggaaatgctgatcgaccgcatcccctgggtggccccc
gagtgcatcggcgaccccaagaacctggcgctcgagtcggacaagtggagtttcggcgcc
accgtgtgggagatcttcagcgggggcaccatgcccacgagtgccctggagcccctgtcg
aaactccagttctaccagaacagcctccagctgccggctcccaagtggacggagctggcc
aatctcatcacccagtgcatggactaccggccgtcctggcgcccctccttccgggccatc
atcagggacctcaacagcctgatcacctcagattacgagctgctgtcggacctggcgccc
agcgagctcccagccaaggatggcttctggggcttcatcacaggcccagtgtgccaggac
cccaccatctatgaggagcggcacctgaagtacatgtgtgtgctgggcaaggggaacttc
ggcagcgtggagctgtgtcgatacgacccgctggacgacagcaccggggagctggtggcc
gtgaagcggctgcagcagagctcggccgagcagctgcaggacttcgaacgggaaatcgcc
atcctgcgcgccctgcacaacgacttcatcgtcaagtaccgcggcgtgtgctacagcctg
gggcggaggagcctgcggctcgtcatggagtatctgcccaaaggctgcctgagggagtat
ctgcagaagaaccaggagcgcctggaccacaagcggctgctgctgtatgcgtggcagata
tgtaagggcatggagtacctgggatcccagcgctacgttcacagagacttggccagcagg
aacatcctggtggagaacgagacccacgtgaagatcggggacttcggcctggccaagctg
ctcccccaggacaaggagtactacgtggtgcgggagccgggacagagccccgtgttctgg
tacgcgcctgagtccctgtcggataacgtgttctcccgcgagtccgacgtctggagcttt
ggagtcgtcctttacgagctcttcacgtacagcaacagaagccaaagcccctccgaggaa
tttctccgcatgatgggactcgacaagcccatgccgatcatttgccacctgctggagctg
ctgaaggacgacaggcggctccctgcgccccccggctgccccgccgaggtgcacggcttg
atgctgagctgctgggccttcagccagagcaaaaggcccaaattcagcgagctggggccg
aagctcgaggcgctgcgcgacagccggagcaaggtccgaggctag

DBGET integrated database retrieval system