KEGG   Chrysemys picta (western painted turtle): 101946823
Entry
101946823         CDS       T04662                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04010  MAPK signaling pathway
cpic04020  Calcium signaling pathway
cpic04260  Cardiac muscle contraction
cpic04261  Adrenergic signaling in cardiomyocytes
cpic04270  Vascular smooth muscle contraction
cpic04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101946823 (CACNA1C)
   04020 Calcium signaling pathway
    101946823 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101946823 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101946823 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    101946823 (CACNA1C)
   04270 Vascular smooth muscle contraction
    101946823 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cpic04040]
    101946823 (CACNA1C)
Ion channels [BR:cpic04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101946823 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 101946823
NCBI-ProteinID: XP_008162493
LinkDB
Position
Un
AA seq 2198 aa
MFQAFVRQATSAYRPLPSLLPGEPEMKYKGKLVHETQLNCFYIQPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNTTISTASSTQRKRQQYGKQK
KQGTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGVNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYFLQGGLPAEEEASPCAPLSAHGRQCQNGTEC
KPGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENE
DEGMDEEKPRNMSMPTSETESVNTDNVAGADIEGENCGARLAHRISKSKFSRYWRRWNRF
CRRKCRAAVKSNIFYWLVIFLVFLNTLTIASEHYNQPYWLTEVQDTANKVLLALFTAEML
LKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITR
YWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTKRSTFDNF
PQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIA
VDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKPAVEEETKEEKIELKSITAD
GESPPTTKINVDDYQPNENEEKNPYPTTEAPAEEEEEEPEMPVGPRPRPMSELHLKEKAV
PMPDASAFFIFSPTNRYLRSCYAAEDPVKHYSFRNQILFYFDIVFTVIFTIEIALKILGN
ADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVK
ILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKL
YSCSDSSKQTEAECRGHYISYKDGEVTQPIIQSRNWENSKFNFDNVLTAMMALFTVSTFE
GWPELLYKSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQ
EYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTIC
LAMQHYGQSCPFKQAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSI
IDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSSSMNAEENSRISITF
FRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAL
NDTSYINRNNNFQTFPQAVLLLFRCATGEGWQDIMLDCLPDKKCDPESEPTNSTEGDHSC
GSSFSIFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPE
AKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVR
TALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEY
FRKFKKRKEQGLVGKLSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAV
SAASEDDIFRRAGGLFGNHVSYYQSDGRSSFPQTFTTQRPLHINKSGNNQGDTESPSHEK
LVDSTFTPSSYSSSGSNANINNANNTALSRFHSPPSYPSTVSTVEGHGTPLSPTIRVQEA
PWKLTSKRTHYYETLGRSSSRDSQLAIVCQEEVSQDETYDENLNEDVEYCSEPSLISTEM
LSYQDDENRQLTPPENNKGEGSRQSPKRGFLRSSSLGRRASFHLECLKRQKNQGVDVSQK
TVLPLHLVHHQALAVAGLSPLLQRSHSPTTFSPRLCATPPAVPCSRGWPQKTIPTLRLDG
VESSEKLNSSFPSIHCSSWYSDSTSCSSPRRARPVSLTVPSQTGGSSRQFHGSAGSLVEA
VLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMENAADNILNGNSKQSPNGNLLPFVN
CRDPGQDSAGEEEEEVQNPDCRKSQEELQDSRIYVSSL
NT seq 6597 nt   +upstreamnt  +downstreamnt
atgtttcaagcctttgttcggcaagctacttcagcatatcgcccactacccagtcttctg
ccaggtgaacctgagatgaagtacaagggcaagttggtgcacgaaactcagcttaactgc
ttctacatccaacctggaggttccaactatgggagtccccgtccagctcatgccaacatg
aatgccaatgcagcggcagggcttgccccagagcatatccctactccaggggcagctctg
tcctggcaggctgctatcgatgctgccaggcaggccaaattgatgggtagtgctggcaat
acaacaatatccacagctagctccacgcagaggaaacgacagcagtatgggaaacagaaa
aaacagggtacaaccacagctacacgtcctccccgggcattgctgtgtttaacgctgaaa
aatcccatccggagggcatgcatcagcatcgtcgaatggaaaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagctatctatatcccctttccagaagat
gattccaatgccaccaattccaatctggaacgagtggaatatctctttctcataattttt
acagtggaagcatttttaaaagtaatagcatatggacttctctttcaccccaacgcttac
ctccgcaatggctggaatttactagattttataattgtggtagtagggctttttagtgca
attttagaacaagcaaccaaagcagatggggtgaattcaataggagggaaaggtgccgga
tttgatgttaaagcactgcgggctttccgagtgttacgccccttacggctggtatctgga
gttcctagtctccaagtggttttaaattccattatcaaggctatggtccccttactgcac
attgccctgctggtgctgtttgtcataattatctatgccatcattggactggagctattc
atggggaagatgcacaagacctgctacttcctgcaaggcggattaccggcagaagaggaa
gcctctccttgtgcccctctatcagcgcatggacggcagtgtcagaatggcactgagtgc
aaaccaggatgggaggggcccaagcatggcattaccaatttcgacaactttgcctttgcc
atgttaactgtgtttcagtgcatcactatggagggctggacagatgtactgtactgggtc
aatgatgccataggaagggactggccctggatctattttgttacactaatcatcataggg
tcattttttgtacttaacttggttctcggtgtacttagcggggagttttccaaagaaaga
gagaaggcaaaggctcggggtgactttcagaagttgcgggagaaacaacagctggaggaa
gacttgaaggggtacctggattggataactcaagcagaagacatcgatccagaaaatgaa
gatgaaggcatggatgaggagaagccccgaaacatgagcatgcctacaagtgagactgag
tccgtgaacacagacaatgtggcgggagcagatattgaaggagaaaactgcggtgctagg
ctggcgcatcggatctccaaatctaagtttagccggtactggcgccggtggaacaggttc
tgcaggaggaagtgccgagctgctgtcaagtccaatattttctactggctggtgatcttc
cttgtgtttctcaacacccttaccatcgcttctgaacattacaaccagccatactggctt
acagaggtccaagacactgccaataaggtgctgctagctcttttcacggcagagatgctg
ctgaagatgtacagcttaggtctccaggcctactttgtatcgctcttcaaccgttttgac
tgctttattgtttgtggaggaatcctggagaccatcctggtggagaccaagatcatgtca
ccgttgggcatctcggtgttgagatgcgtccgactcctgagaatatttaaaatcacaagg
tattggaattccttgagtaacctagtggcttcactgctgaactcagtccgttccatcgct
tccctgttgctgcttctcttcctcttcatcatcatcttctcactcctgggaatgcagctc
tttgggggcaagtttaactttgatgagatgcaaaccaagaggagcacgttcgataacttc
ccccagtccctcctcacggtatttcagatcctgactggggaggactggaattcggtgatg
tatgatgggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttac
ttcatcatcctcttcatctgcggaaactatatcctgctgaatgtatttttggctatcgct
gtggacaatcttgccgatgctgagagtttgacatctgctcagaaagaagaggaagaggaa
aaagaaaggaaaaaactagctaggaccgctagtcctgaaaagaaacaggagattgagaaa
ccagctgtggaggaggagacaaaggaggagaaaattgagctgaaatctatcactgctgat
ggagagtccccgcctactaccaagatcaatgtggatgattatcagcccaatgaaaatgaa
gagaagaacccatatcctactacagaagctccagcagaggaagaggaggaggagcctgaa
atgcctgtcggccctcggccacgcccaatgtctgaactgcacctcaaagagaaggctgtg
cccatgccggatgccagtgcttttttcatcttcagccctaccaacaggtacttgagaagt
tgctatgctgctgaggaccctgtcaaacactactcctttaggaaccaaattctcttttat
tttgatatagtttttactgtcattttcaccattgaaattgctctgaagatcctaggcaat
gcagactatgtcttcactagtatctttacattagaaattattcttaagatgactgcatat
ggagctttcctccacaagggctccttctgcaggaactacttcaacatcctagacttgctg
gtggtcagtgtgtctctcatctcctttgggatccagtccagtgcaatcaacgtagtgaag
atcttacgtgtcctgcgagtgctcagaccgctgagggccatcaacagagccaaggggcta
aagcacgtggtccagtgcgtatttgtagccatcagaaccatcggaaacattgtgattgtc
accactttgctgcagttcatgtttgcctgcattggagttcagttgttcaagggcaaactg
tatagctgcagcgatagctccaagcaaacagaagcagaatgcagggggcattatatttcg
tacaaagatggagaagtcacccagccaatcatccagtcccgcaattgggagaacagcaag
ttcaactttgacaacgtcttgactgccatgatggcactcttcactgtttcaacctttgag
ggctggccagagctgctgtacaaatccatagattctcacatggaggacgtgggacccatc
tataaccacagggtggagatctccattttcttcattatctatatcatcatcattgctttc
ttcatgatgaacatcttcgttggtttcgtcattgtcacgtttcaggaacaaggagagcag
gaatacaagaactgtgagctggacaagaaccagcgccaatgtgttgagtatgccctgaag
gcccgccccctgcggaggtacatccctaagaaccagtaccaatacaaagtgtggtatgtg
gtgaactccacctattttgagtacctgatgtttgttctcatcctgctgaacaccatctgc
ctggctatgcagcactatggtcagagctgtcccttcaaacaagccatgaatatcctcaac
atgctcttcacgggtctcttcaccgtggagatgattctgaaactaatcgccttcaaaccc
aagggttactttagtgatccttggaatgtttttgacttcctcatcgtaattggcagcatt
atagacgtcattctcagtgaaactaatcactatttctgtgatgcatggaatacatttgac
gccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtgaacccagctgaa
catacccaatgctcttcctctatgaatgcagaggaaaactcgcgcatctcaatcaccttt
ttccgactcttccgtgtgatgcgtctcgtgaagctcctgagccgtggggagggcatccgg
acgttgctttggaccttcatcaagtccttccaggctctcccctatgtggctcttttaata
gtgatgttattcttcatctatgcggtgattggaatgcaggtatttggtaaaattgctctg
aatgatacctcgtatataaaccgcaacaacaactttcagacgttcccacaagcagtgctg
ctactcttcaggtgtgccactggtgaaggctggcaggacatcatgcttgattgtctgcca
gacaagaagtgcgatcctgagtcagagccaaccaactctaccgaaggcgaccattcctgt
gggagcagcttttccatcttttatttcatcagcttctacatgctctgtgccttcttgatt
atcaatctttttgtggctgttattatggataactttgactacttgacacgggactggtcc
attctggggccacatcaccttgacgagtttaaaaggatctgggcagagtatgaccctgaa
gccaagggacggatcaaacacctggacgtggtgacgctgctccggcggattcagcctccg
ctgggctttgggaagctctgtcctcatcgagtggcttgcaaacgcctagtctctatgaat
atgccactgaacagtgatgggactgtcatgtttaatgccaccctctttgcattggtcaga
acagcactgaggatcaaaactgaaggtaacctggagcaagccaatgaggagctgcgagcg
atcattaagaaaatctggaagcgcaccagcatgaagctgctggatcaggttgtgcccccg
gcaggcgacgatgaggtgacagtcgggaagttttatgccactttcctgatccaagagtat
ttccggaaattcaagaaacgtaaagaacaaggcctcgtgggcaaactctcacagcggaat
gctctctccttgcaggctgggttgcgcacattgcatgacattgggccagagatccgacgg
gcgatctccggagacctgacagccgaagaggagctagacaaggccatgaaagaagctgtt
tccgctgcctctgaagatgatatcttcaggagggctggtggtctgttcggaaaccatgtc
agctactaccaaagtgatggcaggagctcattcccccagacattcaccacccagcgccct
ttgcacatcaataaatctggcaacaaccagggagatacggagtccccatcacacgagaag
ctagtggattccaccttcactcccagcagctactcgtcttcgggctccaacgccaacatc
aacaatgccaacaatactgccttgtcccgcttccacagcccacccagctacccaagtact
gtcagcacagtggaggggcatggcacacccttgtcacccaccatacgagtgcaggaagcc
ccttggaaactcacttccaaaaggacacattactatgaaacattgggacgctccagttcc
agagacagccagctggcaatcgtttgccaagaggaagtatctcaggatgagacttacgat
gagaatttgaatgaagacgtagagtactgtagcgaaccaagtctgatctctactgaaatg
ctctcataccaagatgatgaaaacagacaactgactccacctgaaaacaacaaaggcgag
gggtcaaggcagtctccaaagagggggtttcttcgctcctcgtcactgggtcgaagagca
tcttttcacttggagtgtctgaagagacagaagaaccaaggtgtagatgtctcccagaag
acagttctgccattgcatctggtacaccatcaggcactagcagtggcagggctgagtccc
ctgctccagagaagccattccccaacaacgttctccccccggttgtgtgccacgccccct
gccgtgccctgtagccgtggctggccacagaagaccatcccgactttacggcttgatgga
gtggagtccagtgagaaactcaacagtagcttcccatcaatacactgcagctcctggtac
tctgacagcaccagctgcagcagccctcggagagccaggccagtctccctcaccgtcccc
agccagactggagggagcagcaggcagttccacggcagcgctggcagccttgtcgaagcg
gtcttgatttcagaaggactgatgcagtttgcgcaagatccaaagttcattgaggtcaca
acccaagagctagcagatgcctgtgacatgacaatagaagagatggaaaatgcagcagac
aacatactcaatggtaacagcaagcaaagccccaatggcaacctcttgccttttgttaac
tgcagggacccagggcaggacagtgcaggagaggaagaggaagaggtgcagaacccggat
tgtagaaaaagtcaggaggagctccaggacagcaggatttatgtcagcagcctgtag

DBGET integrated database retrieval system