KEGG   Chrysemys picta (western painted turtle): 101947252Help
Entry
101947252         CDS       T04662                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00500  Starch and sucrose metabolism
cpic01100  Metabolic pathways
cpic04910  Insulin signaling pathway
Module
cpic_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101947252 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101947252 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cpic01003]
    101947252 (GYS1)
Enzymes [BR:cpic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101947252 (GYS1)
Glycosyltransferases [BR:cpic01003]
 Polysaccharide
  Storage polysaccharide
   101947252 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 101947252
NCBI-ProteinID: XP_005285785
LinkDB All DBs
Position
Un
AA seq 671 aa AA seqDB search
MGPYLEQNVRTQVELIDPPHPAVRRTIDSMNAKGCKVYFGRWLIEGGPYVVLLDVGATAW
SLDRWKTELWESCAIGVPWYDREANDAVLFGFLAAWFLGEFVAQCEEKPFVIGHFHEWLA
GVGLILCRTRKLPVATIFTTHATLLGRYLCAGSVDFYNNLHAFNVDKEAGDRQIYHRYCM
ERAAVHCTHVFTTVSQITAVEAEHLLKRKPDMVTPNGLNVKKFSAMHEFQNLHAQSKAHI
QEFVRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADIFLEALARLNYLLRVNGSQVTVVT
FFIMPARTNNFNVESLKGQAVRKQLWDTANAVKEKFGKKLYESLLVGNLPDMNKMLDKED
FTMMKRAIFATQRHSFPPVCTHNMLDDSTDPVLNTIRRLGLFNSSADRVKVIFHPEFLSS
TSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIAD
PSAYGIYILDRRFRALDDSCTQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRY
YMSARHLALAKAFPDNFTYEPPEETAAQGFRYPRPASVPPSPSISRHSSPHHSETEEDDE
RYDEEEEAEKDRRNIKPPAMTGPVPEWRKPPKKGSSEASTSSNASNASTPTMPSSPSDPS
SPNNSIIEERN
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggggccctacctagagcagaacgtgcgcacccaggtggagctgatcgacccaccccac
ccggccgtgcgacgcaccatcgactccatgaacgccaagggctgcaaggtgtactttggg
cgctggctcatcgaggggggcccctacgtggtgctgctggacgtgggggccacggcctgg
agcctggaccgctggaagacggagctgtgggaaagctgcgccatcggggtgccctggtac
gaccgggaggccaacgacgccgtcctcttcggcttcctcgctgcctggttccttggcgag
ttcgtggctcagtgcgaggagaagccgtttgtcatcggccatttccacgagtggctggcg
ggcgttgggctcatcctgtgtcgtacccgcaagctgccggtggccaccatcttcaccacc
cacgccacgctgctggggcgctacctgtgcgcgggcagcgtcgacttctacaacaacctg
catgcctttaacgtggacaaggaggccggggaccggcagatttaccaccggtactgcatg
gagcgggccgccgtgcactgcacccacgtcttcaccaccgtgtcccagatcacggccgtg
gaagccgaacacctgctcaagagaaaacccgatatggtgacccccaacggcctgaatgtc
aagaaattctctgccatgcacgagttccagaacctccacgcccagagcaaggcccacatc
caggagttcgtccgggggcatttctatgggcacctggactttaacctggacaagaccctg
ttcttcttcatcgccgggcgctacgaattctccaacaagggggctgacatcttcctggag
gcgctggcccgactcaactacctgctccgggtgaacggcagccaggtgaccgtggtgacc
ttcttcatcatgccggctcggaccaacaacttcaacgtggagagcctcaaggggcaggcc
gtgcgcaagcagctctgggacacagccaatgccgtgaaggagaagtttgggaagaagttg
tatgaatcgctgctggtcgggaacctccccgacatgaacaagatgctggacaaggaggat
ttcaccatgatgaagagagcgatattcgccacccagcgtcactccttcccccccgtctgc
acccacaacatgctggacgactctacggatcccgtcctcaacaccatccggcgtctcggt
ctgtttaacagcagtgctgaccgcgtcaaggtcatcttccaccccgagttcctgtcctcc
accagccccctgctgcccgtggactacgaagagttcgtccgaggctgccacctaggggtt
ttcccctcctactatgagccgtggggctacacgccagctgaatgcactgtcatggggatt
cccagcatctcgaccaacctctccggattcggttgcttcatggaagagcatatcgccgac
ccgtcggcctacgggatctacatcctggaccgacggttccgggcgctggatgattcgtgc
acccagctgacgtccttcctgtacagtttctgtcagcagagccggcgccagcgtatcatc
cagcgcaaccggaccgagcgcctctccgacctgctggactggaagtacctgggccggtat
tacatgtctgcccgacacctggcgctcgccaaggcctttcccgacaacttcacctacgag
cccccggaggagacagcggcccaaggattccgctacccccgcccggcctccgtgccccct
tcgccctccatctcccgccactccagcccccaccacagcgagacggaggaggacgacgag
cggtacgacgaggaggaggaggcggagaaggatcggcgcaacatcaagcccccggccatg
acgggccctgtccccgagtggcgcaagccgcccaagaagggctccagcgaggccagcacc
tcctccaatgcctccaacgcctccacccccaccatgccctccagccccagcgaccccagc
agccccaacaactccatcatcgaggagaggaactag

DBGET integrated database retrieval system