KEGG   Chrysemys picta (western painted turtle): 101947542Help
Entry
101947542         CDS       T04662                                 

Gene name
DOT1L
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101947542 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cpic03036]
    101947542 (DOT1L)
Enzymes [BR:cpic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101947542 (DOT1L)
Chromosome and associated proteins [BR:cpic03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101947542 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 101947542
NCBI-ProteinID: XP_005283912
LinkDB All DBs
Position
Un
AA seq 1743 aa AA seqDB search
MGERLELRLKSPVGAEPAVYPWPLPVYVKHHXGSGELMETVMWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWKERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNTTTPTKVR
ENKDSGAEEEKVGTNAVKKTSPSKARKKKLSKKGRKMAGRKRGRPKKMNTANTERKTKKN
QTALELLHAQTVSQTPSSSPQDAYKSPHSPYYQLPPKVQRHSSNQLLVTPTPPALQKLLD
SFKIQYMQFMAYMKTPQYKANLQQLLEQEKEKNAQLLGTAQQLFTHCQAQKEEIKRLFQQ
KLDELGVKALTYNDLIQAQKEISAHNQQLKEQTKQLEKDNSELRNQSLQLLKARCEELKL
DWSTLSLESLLKEKQALKNQISEKQKHCLELQISIVELEKSQRQQELMQLKSYMPPDESL
SVQLRNKNRLSREPEADHGRFQLELECSKFPMPHINGMSPELSMNGHATPYEIHNALSRP
SSKQNTPQYMTSHLDQEIIPCTPNHSNRQKVDKTASLSLPDYTRFSPAKIALRRHLNQDH
AVNGKATTNEIHQRADHVKENGLTYPSPGISNGIKLSPQETRPSSPAALPIAGEKVLRER
TSASNGETITSLPISIPLSTVQPNKLPVSIPLASVVLPSRVEKVRSTPSPVHQNRDSSST
LEKQYGASSHNGISNAAGNKPLALATSGFSYSSGSMAVNGTLSNSPAHLNHSVDQAAADD
SGSLFNSVGSRSSTPQYPSLLMMQSRNSGQNSPAHQHSASPKLNGASQSMVGVLQYVDAQ
KMFAEGTKGELQPDAAFSDPENEAKRRIIFTISPGTGSIKQSPSNKHSPLTASIRMDCGQ
AYMQDGKKRGRRKRSSTGNLNMNSGVSPKRKSLPTVAGLFTQPSGSPLNINSMVNNINQP
LEITAISSPENSLKNSPVPYQDNDQPPVLKKEKPLIQTNGVHYSPLTSDEEQGSEDEHNS
TRIERKIATISLESKSPQKTIENGGSLAGRRQAQTSENMNSSKWKSTFSPISDINLTKTT
DSPLQAVSSLSQNSLFAFRPSSEDGMAIDAKIAAHTRKNITMSSSGTDRLSPNTNSTNGS
MYNGGLTTDIGLHSFIDGASLPHKTSDVTTLNSSLGFQSQRSKDVGILETNPFLNKRQLE
GLGSMKGEDLNRSGVKSKEISELTIRPGAASEKSSLQHNGKVGKGRDRDVEFKNGHNLFI
SAAAVSSGGLLNGKSLSTGVSSAGNPAPSVQTHHPFLNTLTTGSQFPLGPMALQANLNSV
TNASVLQSLFNSMPAAASLVHVSSAATRLTNSHAMGNFSSGVTGGTVGGIFNHAVPSASS
SHQFGASFSSSAVSSSTMLSLNPLQAVASTSSFQSPSSSLVTSSENRAAQHLNRVPVQTV
FHTPPPPPPNVSLPPPPPLLASNSEPALLQNLPSIPANDAFLPSSSAASVQSANASLSIK
LASLQHKTSRPSFTVHHPPLPRLALAQTAPMIPQSNATGTSAMWVTLGMQSPYASHLSGV
KPR
NT seq 5232 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagaggctggagctcaggctgaagtcgcccgtgggagccgagccggccgtttac
ccctggccgctgcccgtctatgtgaagcaccactagggatctggggaactaatggagaca
gttatgtgggtctgtgaagaaatcccagatctcaagcttgccatggaaaattatgtttta
attgactatgatacaaaaagctttgaaagcatgcagaggctttgtgacaaatacaaccgt
gccattgatagcattcatcagttgtggaaaggaaccacccagcccatgaaattgaacact
cgtccctccaatgggctcctccgtcacatcttgcagcaagtatataaccactcggtgact
gacccagagaaactcaacaactatgagcccttttccccagaggtgtatggagagacttcc
tttgatttagtggcccaaatgattgatgagattaaaatgactgaggatgacttgtttgtt
gacttgggcagtggtgtgggtcaggtcgtgcttcaagttgctgctgccacaaactgcaaa
catcactatggtgtggagaaagctgatattccggccaaatatgctgagacgatggacaga
gagttcagaaagtggatgaaatggtatgggaaaaaacatgcagaatacacactggaaaga
ggtgacttcctctcagaagaatggaaagaaagaattgcaaacacaagtgttatttttgtg
aataattttgcctttggtcctgaggtggatcaccaactgaaggagcgatttgcaaacatg
aaggaaggtggcagaatcgtgtcctcaaagccttttgcacctctaaactttagaataaac
agtcgaaacttgagtgatattggcactataatgagagttgtggagttatccccactgaaa
gggtcagtttcatggaccgggaaaccagtttcttactacctgcatactattgatcgcacc
atacttgaaaactatttttctagtctcaaaaatccaaaactcagggaggaacaagaggca
gctagacgtcgtcagcaaagagaaaacaagagcaacacaactactccaacgaaggtgcga
gaaaacaaggattctggtgctgaagaagaaaaagttgggacaaatgcagttaaaaagaca
tccccctccaaagcacgcaagaaaaagctgagtaagaaaggaaggaaaatggccgggcgg
aagcgagggcgtcccaagaaaatgaacactgcaaatacagagcgcaagaccaagaagaac
caaactgcactagagcttctgcatgctcaaactgtgtcacagacaccctcatcctctcct
caggatgcatacaagtcacctcatagtccatattaccaactacctcctaaagtgcaacgg
cattcatctaaccaactgttggtgactcctaccccacctgcactacagaagctgctagac
tcttttaagatccaatacatgcagttcatggcgtacatgaaaactcctcagtacaaagca
aacctgcaacagttactggagcaggaaaaggaaaagaatgctcaattgctggggacagca
caacagttattcacccactgccaggcacagaaagaggaaattaaacgtctctttcaacag
aaactcgatgagttgggagttaaagctctgacatataatgacctgattcaggctcagaag
gagatctccgctcacaaccagcagctgaaggaacagacaaagcagctggagaaagataac
agcgaactcaggaaccagagcttgcagctgcttaaagcacgatgcgaagaactgaagttg
gattggtcaacgctgtcgttggagagcttactgaaggaaaagcaggcactgaagaatcag
atttctgagaaacaaaagcactgtttggaattgcagatcagcattgtggagcttgagaaa
agtcaaaggcagcaggagctcatgcagctgaaatcgtatatgcctcctgatgagtctctg
tcggttcaactacgcaataaaaaccgtttaagccgtgagcccgaggctgatcacggcaga
ttccaacttgagcttgagtgctctaaatttcctatgccccacatcaatggcatgagccct
gaactgtccatgaatggccatgctactccctatgaaatccataatgctcttagcaggccc
tcttccaagcagaacacccctcaatacatgacctctcacctggaccaagaaataattcct
tgcaccccaaaccacagcaacagacagaaggtggacaagacagcaagcttgtccttacct
gattacaccaggttttccccagctaagatagccctaaggagacacttgaatcaggaccat
gcagtcaatggaaaagcaacaactaatgagatacaccagagagctgaccatgtaaaagag
aacggccttacatatccaagccctggcatttcaaatggcataaagctgagtcctcaggaa
actcggccctcttccccagcggccttaccgattgcaggcgagaaggttttgcgagagagg
acttctgcgagtaatggagaaactatcaccagcctacctatcagtattcctctcagcacg
gtgcagcccaataaactccctgttagtatccctctggccagcgtagtcctacctagccgt
gttgagaaggtgagaagcacacctagtccagttcatcagaatcgagactcgtcgtcaaca
cttgaaaaacagtatggtgctagttctcataatggcataagcaatgctgctggaaataag
ccactggctttggctacctcaggtttttcatattcttctggctccatggcagttaatgga
actctttcaaacagccccgcccaccttaaccatagtgttgatcaggcagctgcggacgac
tctgggagtttgtttaactcggtagggtctcggagctccactccacaatacccttctttg
ctaatgatgcagtcacggaactctgggcagaactccccggctcaccagcactcagcaagc
cccaagttaaatggtgcctcccagagcatggtaggggtactgcagtacgtggatgctcag
aagatgtttgccgaaggaacaaagggggaacttcagcctgatgccgccttttccgatcct
gagaatgaggccaagagaagaatcatcttcacaatctctcctggtacaggaagtataaaa
cagtctccgtctaacaagcacagtcccctgacagcaagcattcggatggactgtggccaa
gcatacatgcaggatgggaagaaacgaggtcgaaggaagagatcctccaccgggaatcta
aacatgaactccggggtgtcccctaaacgcaaatccttaccaactgtggctggactcttc
actcagccttcaggctcaccacttaatataaactcaatggtcaataacattaatcagcct
ttagaaataacagccatttcctcccctgaaaactccctgaagaactctcctgttccctac
caggacaatgaccagcctccagtgctgaagaaagagaagcccctgattcagaccaacggt
gttcattactcgccactgacttcggatgaagaacagggatcggaagatgagcacaatagc
accagaattgagaggaaaattgcaacgatatcattggaaagcaaatctccacagaagact
attgaaaatggtggcagtttagctgggaggagacaagcacaaaccagtgagaacatgaat
agcagtaaatggaagtctaccttttcaccaatttctgacatcaacctgaccaaaactacc
gatagcccattgcaggctgtttcatctctgagccagaattccctgtttgcctttaggccg
tcctctgaggatggcatggccatcgatgccaaaattgcagcacacacacggaaaaacatc
accatgtcctcctctgggacggacagactcagccccaatacaaactccactaatggatcc
atgtataacggtggactgaccacagacatcggtttacacagctttattgatggtgcttct
cttcctcataagacttcagatgtgacgaccctcaactcctctctgggttttcagtcacag
aggagcaaagatgtggggattttggagacaaacccctttttgaacaagaggcagcttgaa
ggcctaggcagcatgaaaggagaagacttaaaccggtcaggggtcaaaagtaaagagatc
agtgaattaaccattcgtccaggggcggcttctgaaaaaagttccttgcagcacaatggc
aaggtcggcaaaggacgggaccgagatgtggagtttaaaaacggccacaaccttttcatt
tctgctgctgctgtatcttctggtggccttctcaatggcaaaagcctttccactggtgtc
tcatctgcaggcaacccagcaccttctgttcagacgcatcatcctttcttaaacacattg
accactggatcgcagttccccctgggccccatggctttgcaggcaaacctcaactcggtc
acaaacgcctcagtattgcagtccttatttaattccatgccagctgctgccagtctggtc
cacgtgtcatcagctgcaaccagactgactaactctcatgctatggggaacttctcttct
ggggttacaggtggaacagttggaggtatttttaaccatgcggtgccttctgcctcctct
tctcatcagtttggagccagtttcagcagcagtgctgtttctagcagcacaatgctaagc
ttaaaccctctgcaggctgtggccagcacctcatccttccagtccccctcctctagctta
gtaacgtccagtgagaacagagctgcccagcacctaaacagagtgccagtgcagactgtg
tttcatacccctcctccaccccctcctaacgtttcattacctcctcctcctccattactc
gcttctaactctgagcctgcgcttctgcagaacttgccgtccatcccagctaacgatgct
tttttaccatcctcgtccgctgcttctgtccaatctgctaatgcttctttgtctattaag
ctagcttctcttcagcacaaaacttcccgtccctcctttacagtccatcacccacctctg
ccccgtttggcgctggcacagaccgcgcccatgatcccgcagtccaacgcaactggcacg
tccgctatgtgggttacacttggcatgcagtctccttatgcttcgcacctttctggggtt
aagccgcgataa

DBGET integrated database retrieval system