KEGG   Chrysemys picta (western painted turtle): 101948144Help
Entry
101948144         CDS       T04662                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00512  Mucin type O-glycan biosynthesis
cpic01100  Metabolic pathways
Module
cpic_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101948144 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cpic01003]
    101948144 (GALNT9)
Enzymes [BR:cpic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101948144 (GALNT9)
Glycosyltransferases [BR:cpic01003]
 O-Glycan biosynthesis
  Mucin-type
   101948144 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 101948144
NCBI-ProteinID: XP_005299585
LinkDB All DBs
Position
Un
AA seq 605 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRLQERSPELVQIVRSADRRLRSRHAKGLGGLS
ERESILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGMAATLRDDSHESETKYEEYG
YNAQLSDRISLDRSIPDYRPKKCKQMTYSDDLPQISVVFIFVNEALSVILRSVHSVVNHT
PSHLLKEIILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNNKREGLIRARIQGWKAATS
PIVGFFDAHVEFNTGWVEPALTRIKEDRKRIILPAIDNIKYNTFEVQQYANAAHGYNWGL
WCMYIIPPQDWLDKGDESAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGM
RVWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNI
PMTNPGVDFGDVSERIALRQRLQCRSFKWYLENVYPEMRVYNNTITYGEVRNSKASGYCL
DQGAEDDDKAILYPCHGMSSQLVRYSSEGLLQLGPLGSTAFLPDSKCLIDDGKGRTPTLK
KCEDVLRPAQRLWDFTQNGPIISRNTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWI
KHGRH
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcacggaaaatcaaaactttgttgacggtgaacatcttggtcttcgtgggg
atcatcctcttctccgtgtactgccggctgcaggagcgctccccggagctggtgcagatc
gtccggagcgccgaccgccggctccgcagccgccacgccaaggggctgggcggcctgagc
gagcgggagtccatcctgcagcgcctggaccacctggaggaagtggtgtacaaccagctc
aatggtctagccaagcccatgggactagttgaaggtccaggaggcttgggccagggagga
atggctgctaccttgagagatgacagtcatgaatctgagactaagtatgaagaatatggt
tacaatgcccagctcagtgacaggatatcactggataggtccattcctgactacagacca
aaaaagtgcaaacagatgacctattccgatgacctgccccagatctcggtggtctttatt
tttgtaaacgaggctctgtctgtcatcttgcgctcagtgcacagtgttgtgaaccatacc
ccatcccatttgctcaaggagatcattctggtggatgacaacagtgataacgttgagctg
aagtttaatctggaccagtatgtcaataagagatacccaggcctggtgaagatagttcgc
aataacaaacgggaaggactgattcgagccagaatccaaggctggaaagcagcaacttct
ccgatcgttggtttcttcgacgctcatgttgagttcaacactggctgggtggaaccggcg
cttacccggatcaaagaagatcgaaagcgaatcatcctaccagctattgacaacatcaag
tacaacacgttcgaagtgcagcaatacgccaatgctgcccacggctacaactggggactc
tggtgcatgtatataatcccgccccaggactggctcgataaaggggacgagtctgctccc
atcaggacgccagcaatgattggatgttcgtttgtggtggaccgagagtacttcggggag
attggcctgcttgaccctggcatggaggtctatgggggagaaaatattgaactgggcatg
agggtctggcagtgcgggggaagcatggaagtgttaccttgctcgagagttgcccacatt
gaacgcacaaagaaaccttacaacaatgacattgattactatgcaaagcgcaatgccctg
cgggctgctgaggtctggatggatgacttcaagtcacatgtttacatggcatggaacata
ccaatgacaaacccaggagttgacttcggagatgtttcagaaagaatagctctacgacag
cgactgcagtgccggagttttaagtggtacctggaaaacgtctatcctgaaatgagggtt
tacaacaatacaatcacttacggagaggtacgtaacagcaaagctagcggctactgttta
gaccagggagcagaagatgatgacaaagcgatcctctacccatgccatggaatgtcctcc
cagcttgtccgatatagttctgaagggctcctgcagttagggcctctcggctccacggcc
tttctgcctgactccaaatgtctcattgatgatgggaaaggcaggaccccaactctgaag
aaatgtgaagatgtcttgagaccagcacaaagactctgggattttacacagaatggtcca
atcatcagcagaaacactggacggtgtctagaagtggaaatgtcaaaggatgccaatttt
gggctcagacttgtggtacaaaggtgctcggggcaaaaatggatgattagaaactggata
aaacatggtcgacattga

DBGET integrated database retrieval system