KEGG   Chrysemys picta (western painted turtle): 101948171
Entry
101948171         CDS       T04662                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00230  Purine metabolism
cpic01100  Metabolic pathways
cpic04020  Calcium signaling pathway
cpic04114  Oocyte meiosis
cpic04261  Adrenergic signaling in cardiomyocytes
cpic04270  Vascular smooth muscle contraction
cpic04371  Apelin signaling pathway
cpic04540  Gap junction
cpic04912  GnRH signaling pathway
cpic04914  Progesterone-mediated oocyte maturation
cpic04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101948171 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101948171 (ADCY3)
   04020 Calcium signaling pathway
    101948171 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101948171 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101948171 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101948171 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    101948171 (ADCY3)
   04916 Melanogenesis
    101948171 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101948171 (ADCY3)
   04270 Vascular smooth muscle contraction
    101948171 (ADCY3)
Enzymes [BR:cpic01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101948171 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053
Other DBs
NCBI-GeneID: 101948171
NCBI-ProteinID: XP_008172116
LinkDB
Position
Un
AA seq 1116 aa
MPGNRAFSEPEYSAEYSADYSVSLPSDPERGVGRTHEVTVRNSGSCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIVMCAVVYTTDKLAPILVASVGLAADIL
LFVLCKYGLLPDRISRKFLPYVLWILIAAQIFCYLGLNFSHFHEASDTVGWQAFFVFSFF
ITLPLRLTPIVLITAISCGIHTLVLGVTIAQQQQDSINGEALLRQILSNVAIYLCSITVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAHELVKLLNELFARFDKLAAKHHQ
LRIKILGDCYYCICGLPDYREDHAVCSIMMGLAMVEAISYVREKTKTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGEGGTRCE
YLKEKGIVTYLIVVPKQPLKNGINGVKLSLTSSHGNSPLLINTKECNGSINTTCTTPDEA
EELDTRVVNPSFPNPRRRLRLRDLAERVVDASQNEQELNNLLNEALLERESVQALKGKYT
YRLSMRFINPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEILIDPWLVANYVTFVIGE
ILLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMSAIFILTMADIVDMLSCL
QFYSSTSNSTAGTLLAGGCVEDPKYYSFIAVLALIATIMLVQVSHMVKLTLMVMITGAVG
VVNIYAWQQIFDEYDKERFKENVSALVPSKYSMTVMVFIMMLSFYYFSRHVEKLARTLFL
WKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASL
PNFADFYTEESINNGGIECLRFLNEIISDFDALLDDPQFRCITKIKTIGSTYMAASGVTP
DVNTNGYNTTIKKEELSEKERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGMNKGA
VLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHLVLKEYGFRFMRRGAIYV
KGKGELLTFFLKGREKQGSFVNGSSVTLPHQVVDSS
NT seq 3351 nt   +upstreamnt  +downstreamnt
atgcccgggaacagggccttctctgagccggagtactcggccgagtactcggctgactac
tcggtcagcctaccctccgaccccgaacgtggggtgggccggacccatgaggtgacagtg
aggaactcgggctcatgcctctgcctgccgcgtttcatgcggctcaccttcgcccccgag
tccctggagaacctctaccagacttacttccgccggcagcgccacgagaccctcttggtg
ctggtggtcttcgctgccctcttcgactgctatgtcattgtcatgtgtgccgtggtctac
accacagacaagctggcccccatcctggtggcctccgtgggcctggccgccgatatcttg
ctcttcgtcctatgcaagtacgggctcctgccagaccgcatctcccgcaagttcctgccc
tatgtcctctggattctcatcgctgcccagatattctgctacctgggcctcaacttttcc
cacttccacgaggccagtgacacagtgggctggcaggccttcttcgtcttctccttcttc
atcaccttgcccctgcgcctcacgcccattgtgctcatcacggccatctcctgcggcatc
cacaccctggtgctgggggtcaccatcgctcagcagcagcaggactccatcaacggagag
gccttgctacggcagatcctgtccaatgtcgccatctacctgtgctccatcacggtgggc
atcatgtcctactacatggcagatcgcaagcaccgcaaggccttcctggaagcacggcag
tctctcgaggtcaaactcaacctggaggaacaaagccagcagcaggaacggctgatgctt
tccatcctgcccaagcacgtggcagatgagatgctaaaggacatgaagaaggacccgagc
cagaaagagatgcagcagtttaacaccatgtacatgtaccgccatgagaatgtcagcatc
ctctttgctgacatagttggcttcacccagctgtcgtcctcctgcagcgcccacgagctg
gtgaagctgctgaatgagctcttcgcccgcttcgacaagctggccgcgaaacaccaccag
ctgcgcatcaagatcctcggagactgctattactgtatctgtgggctgccggactaccgt
gaggaccacgccgtctgctccatcatgatgggactggccatggtggaagccatatcctac
gtgcgagagaagaccaaaacggacgtggacatgcgggtgggggtccacagcggcacggtg
ctgggtggcgtgctgggccagaagcgctggcagtacgacgtgtggtccacagatgtcacg
gtggctaacaagatggaggctggcggcatcccagggcgtgtacacatctcccagagcacc
atggactgcttgaaaggggagttcgaggtggagcccggtgagggggggacaaggtgcgag
tacctgaaggagaaggggatcgtcacgtacctcatcgtggtgcccaagcagcccctcaag
aatgggatcaacggagtgaagctgtccctgacgtcctcccatgggaactccccgctgctg
atcaacaccaaggagtgtaacggcagcatcaacaccacctgcaccacgcccgacgaggcc
gaggagctggacaccagggtggtgaacccctccttccccaacccccggcggcggctgcgt
ctgcgcgacctggccgagagagtcgtcgacgcctcgcagaacgagcaggagctcaacaac
ctgctcaacgaagccctgctggagagggagtctgtgcaggcgctgaaggggaaatacacc
taccgcctctccatgcgcttcatcaacccggagatggaaacgcgctactccgtggagaag
gagaagcagagcggggccgccttcagctgctcctgcgtggtgctcttcttcaccgccctg
gtggagatcttaatcgatccctggctggtggccaattatgtgacgtttgtaattggagaa
atcctgctgctcatcctgactctctgctctctggcagccattttccccagggtatttccc
aaaaaactcgtagccttttccacttggatcgacaggacccggtgggcccggaacacatgg
gccatgtcggccatctttatcctcaccatggctgacatcgtggatatgctcagctgcctg
cagttctactccagcaccagcaacagcaccgcagggaccctgctggcagggggctgcgtg
gaggaccccaagtattacagcttcattgccgtgctggccctcatcgccaccatcatgctg
gtgcaggtcagccacatggtcaagctcaccctgatggtcatgatcaccggggcagtgggc
gtggtcaacatctatgcctggcagcagatcttcgacgagtacgataaggaacgcttcaag
gagaacgtgtccgccctggtcccctccaagtactccatgacagtgatggtcttcatcatg
atgctcagcttctactacttctctcgccacgtggagaagctggccaggacgttgttcctg
tggaagatcgatgtccatgaccagaaggagcgggtgtacgagatgaggcgctggaacgag
gctctggtcaccaatatgttgccggagcacgtggcccggcatttcctgggctctaagaaa
cgggacgaggagctgtacagccagtcgtacgacgaaatcggcgtcatgtttgcctccctc
ccaaactttgctgacttctacacggaggagagtatcaacaacggcgggatcgagtgcttg
cgcttcctcaacgagatcatctcggacttcgacgcgctcctggacgatccccagttccgg
tgcatcaccaagatcaaaactattggaagcacctacatggctgcttctggagtgaccccc
gatgtcaataccaatggctacaacaccaccataaagaaagaggagctctcggagaaggag
cgttggcagcacttagctgatttggccgactttgccttagccatgaaagtgaccctgatg
aacattaactaccagtccttcaacaacttcatgctccgaataggcatgaataaaggggca
gtgctggcaggagtgatcggcgcccgcaaaccacactacgacatttgggggaacacggtg
aacgtggccagcaggatggagtcaacgggcgtgatggggaacatccaggtggtggaagag
acccatctcgtcctgaaggagtacggcttccgctttatgcgccggggggccatctacgtc
aaaggcaaaggggagttgctgaccttcttcctgaagggccgggagaagcagggctctttc
gtcaatggctcctcagtgactcttccacaccaggtggtcgacagctcatga

DBGET integrated database retrieval system