KEGG   Chrysemys picta (western painted turtle): 101948638Help
Entry
101948638         CDS       T04662                                 

Gene name
NKX3-1
Definition
(RefSeq) NK3 homeobox 1
  KO
K09348  homeobox protein Nkx-3.1
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cpic03000]
    101948638 (NKX3-1)
Transcription factors [BR:cpic03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    101948638 (NKX3-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN Homez
Motif
Other DBs
NCBI-GeneID: 101948638
NCBI-ProteinID: XP_005285214
LinkDB All DBs
Position
Un
AA seq 257 aa AA seqDB search
MSSRAPLPGREEGQGSTEPPRGKSHPGTPQQQPAGRSLPQGSLPHSSKPLTSFLIQDILR
DGADRGSAGKGRKSRGCCGASSPEPALDSASSAPRQPAGKPLPEGVPPPPSEQPGEPDAE
AYTETNLSDCENPLKSSPSNQRTPKQQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHL
AKNLKLTETQVKIWFQNRRYKTKRKQLASELSGLDKNSVFPVLKEDDVSKASLISVYNSY
QYYPYLYYSNGWSPSLW
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccgggcaccccttccaggaagggaggagggacagggcagcacagagcccccc
agaggcaagagccaccccgggaccccgcaacagcagccagcggggaggagccttccccag
ggctcgctgccccactcctccaagccgctcacgtccttcctcatccaagacattctgcgg
gacggtgcggaccgcggatctgcggggaaagggaggaagagccggggatgctgcggtgcc
tctagcccggagcctgcgctggacagtgcaagctccgctccccggcagccagctgggaaa
cccctccctgaaggggtccccccgccaccctcggagcaaccaggagagccagacgcagag
gcatatacggagaccaacctgtcagactgtgaaaaccctctgaaatcctcaccgagcaac
caaaggaccccgaagcagcaaaagcgctcacgggcagccttctcccacactcaggtcatc
gagttagaaaggaagttcagtcatcagaagtatctgtccgccccggagcgagcccacctg
gcaaagaacctgaagctcactgaaacccaggtgaaaatctggttccagaacagaaggtac
aaaaccaaaaggaagcaactagcctcagaactcagtggactcgataagaactcagttttt
ccagtccttaaagaggatgatgtctccaaggcctctctgatttctgtgtataacagctac
cagtactatccatacctgtactactcgaatggctggagtccctctttgtggtaa

DBGET integrated database retrieval system