KEGG   Chrysemys picta (western painted turtle): 101948982
Entry
101948982         CDS       T04662                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04141  Protein processing in endoplasmic reticulum
cpic04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101948982 (ATF6B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101948982 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cpic03000]
    101948982 (ATF6B)
Transcription factors [BR:cpic03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101948982 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 101948982
NCBI-ProteinID: XP_008174854
LinkDB
Position
Un
AA seq 631 aa
MAALAPELLLLHDSGRFLADNLLSSEDWDAALYSCLDDGEEPAALFPCLEPSALFDDGFD
LGMDTSPPEPPWDQMPTSLFPDLQVKSEPVSPASSHSSDSSILSMTPDPTRQAASPDDVM
GVKAEHPPTPPCMFGDVLAPPVGTVQINLLPAPETQTTPGKPVTPIKAESILSRKPPIQP
KPVVVATVPVQPAATPSSTILLQTVPGAQPQPLKPAITVPAPSVVISQSDLLHLPLSGLL
KVQPPGKEGPPARLPPSAPKPEAKTIVPAPSQLGPCNPEIDVKVLKRQQRMIKNRESACQ
SRRKKKEYLQGLECRLREALAENERLRRENTLLRRRLDCVLGESRELKFSPGNRKVVCVM
VVLLFIAFNFGPVSISEQKAVETAPPRQGAGAGQSRRHLLGVMEQPPKEEPRELREELAP
TSVGKTRFRNLTAALSGMKDLMLRDLDKLFLASDCRHFNRTESLRLADELSGWVRRHQIN
RRKPLQSRKPRANQESPPRKVPSPSRYVPASPPERPERDSLSELQVYQRPDRTEHHFMDA
IDRREDTFYVVSFQSLYNASRGFEVMMQIDCEVMDTRVIHIKSSTVPPFLRRPPAPDNRT
QAPSVQPRPGRGPLRSARRPRTFYLGEQGEG
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggcggcgctggccccggagctgctgctgctccacgactcgggccggttcctggccgac
aacctgctgagcagcgaggactgggatgcggctctctacagctgcctggacgatggggag
gagcccgccgccctcttcccctgccttgagcccagtgcattgtttgacgacggtttcgac
ctgggcatggacaccagcccgccagagccgccgtgggaccagatgccaaccagcctcttc
ccggacctccaggtgaagtctgagcccgtgtcccccgcttcctcccacagttcagactcc
tccatcctctccatgacccccgaccccacgagacaggccgcaagcccagacgacgtgatg
ggagtgaaagccgagcaccctccgaccccaccctgcatgtttggggatgtcctggccccc
ccagttggcaccgtccagatcaaccttctgccagcgccggagacacagacaacgccaggg
aagccagtgactcccatcaaggctgagtcgatcctgagccggaagccacccatccagcca
aagccggtggtggtggccaccgtcccggtgcagcccgcggccacccccagctccaccatc
ctactgcagacggtgccgggggcccagccgcagcccctcaagccagccatcacagtccca
gcaccgtctgtcgtcatctcccagagcgacctcctgcacctcccgctctcggggctcctc
aaggtgcagcccccggggaaggagggccccccggccaggctcccccccagcgcccccaaa
cccgaggccaaaaccatcgtcccggccccgagccagctcggaccctgcaacccagagatt
gacgtgaaggtgctgaagcggcagcagcggatgatcaagaaccgggagtcggcctgccag
tcgcgccggaagaagaaagagtacctgcaggggctggagtgccgcctgcgggaggcgctg
gctgagaacgagcggctacggcgggagaacaccctgctgcggcgccggctggactgcgtc
ctgggcgagagcagggagctgaagttcagccctgggaaccggaaggtcgtttgcgtcatg
gtcgtgctgctcttcatcgccttcaactttgggcccgtcagcatcagcgagcagaaggcc
gtggagacggcgccgcccaggcaaggggcgggggccgggcagagccgccggcacctgctg
ggtgtgatggagcagccgccgaaggaagagccgagggagctgcgggaggagctggccccc
accagcgtgggcaagaccaggttcaggaacctcacggccgccctctccggcatgaaggac
ctgatgctgcgggacctggacaagctgttcctggcgtccgactgtcgccacttcaaccgc
acggagtcgctccggctggcggacgagctcagcggctgggtgcgtcggcaccagatcaac
cgcaggaagcccctgcagtcccgcaagccacgcgccaatcaggagtcgcccccgaggaag
gtgcccagcccatcgcgatacgtcccagctagcccccccgaacgcccagagagggactcg
ctgagcgagctgcaggtctaccagcgccccgaccgcacggagcaccacttcatggacgcc
atcgaccggcgggaggacacgttctacgtggtctccttccagagcctgtacaacgcgtcg
cggggcttcgaggtgatgatgcagatcgactgcgaggtgatggacacacgggtgattcac
atcaagagctccacggtgccgcccttcctgcgccgccctccggcgcccgacaaccgcacc
caggcgccctcagtgcagccccgcccgggccgaggtcccctgcgctctgcccggcgcccc
cgcaccttctacctcggggagcagggcgagggctag

DBGET integrated database retrieval system