KEGG   Chrysemys picta (western painted turtle): 101949044Help
Entry
101949044         CDS       T04662                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00010  Glycolysis / Gluconeogenesis
cpic00030  Pentose phosphate pathway
cpic00051  Fructose and mannose metabolism
cpic00052  Galactose metabolism
cpic01100  Metabolic pathways
cpic01200  Carbon metabolism
cpic01230  Biosynthesis of amino acids
cpic03018  RNA degradation
Module
cpic_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101949044 (PFKM)
   00030 Pentose phosphate pathway
    101949044 (PFKM)
   00051 Fructose and mannose metabolism
    101949044 (PFKM)
   00052 Galactose metabolism
    101949044 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101949044 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:cpic01009]
    101949044 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:cpic03019]
    101949044 (PFKM)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101949044 (PFKM)
Protein phosphatases and associated proteins [BR:cpic01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101949044 (PFKM)
Messenger RNA biogenesis [BR:cpic03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101949044 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101949044
NCBI-ProteinID: XP_005291957
LinkDB All DBs
Position
Un
AA seq 831 aa AA seqDB search
MHFPVMWSPLDLSVVGSKLFISVSLAFAVFFFFTFFPFSQKKKEPPAKKMSQPPEKHERT
HNLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGAKVYFVHEGYQGLVDGGDNIQEAT
WERVSMMLQLGGTVIGSARCQDFRMREGRLKAARNLVKRGITNLCVIGGDGSLTGADTFR
AEWSSLLVELVKTGGVTAEEAKNSSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIMEIV
DAITTTAQSHQRTFVLEVMGRHCGYLALITALACGADWVFIPESPPEDDWEEHLCRRLIE
TRGRGSRLNIIIVAEGAITKQGQPITSENIKNLVVKRLGYDTRVTILGHVQRGGTPSAFD
RILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTTAMNEGRFDD
AVKLRGRSFQNNWNVYKLLAHVRPPSTKSGYNLAVMNVGAPASGMNAAVRAAVRIGLIHG
HKMLAVHDGFDGLAHGQVEEIGWGGVGGWTGLGGSKLGTKRTLPKKYLEEISATISSFNI
QGLIVIGGFEAFTGSLELVEGRGKYEELCIPVCVIPATVSNNVPGSDFSIGADTALNTIT
TTCDRIKQSSAGTKRRVFIIETMGGYCGYLATMAGLASGADAAYIFEDPFTIRDLQVNVE
HLCEKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFESRKNVLGHMQQGGTPTP
FDRNFGTKMGAKSVAWLTGKIKEYSRHGRIFANTADSACLLGMRRRSLVFQPLAELEEQT
DFEHRLPKQQWWLKLRPILKILAKYKADLDTSEKAHLEHITHKVVPVEANI
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgcactttccggttatgtggtctccattggacctctctgtagttgggtccaaacttttc
atttctgtgtcacttgcttttgcagttttctttttcttcaccttcttcccgttctcccag
aaaaaaaaagagccaccagctaagaaaatgtcgcagccaccagaaaaacatgagcgcaca
cacaacctggggattgggaaagccattgctgtgctgacctcgggaggagacgcgcagggc
atgaatgcagctgtccgggccgtggttcgagtgggcatcttcacaggagccaaggtgtac
tttgttcatgagggttaccaaggactggtggacggcggtgacaacatccaggaggccaca
tgggaacgcgtctccatgatgcttcagctgggcggcactgtaattggaagcgccagatgc
caggacttccgcatgcgtgagggtcgtctgaaagccgcccgcaacctggtgaagagaggc
atcaccaacctgtgtgtcatcgggggagacggcagtctgaccggagcagacaccttccgg
gccgagtggagcagtttgctagtggaactggttaaaacaggtggcgtcacagcagaggaa
gccaagaactcgagtcacctgaacattgtaggaatggtcggctccatcgataacgacttt
tgcggcacggacatgacgataggcacagactccgcccttcacaggataatggagatagtc
gatgctataacgacgactgcccagagtcaccagaggacgtttgtgctggaggtgatgggc
cgtcactgcggctacctagctctcataacggccctggcttgtggtgccgactgggttttc
attcccgaatctccgcctgaggatgactgggaggaacacttgtgcaggaggctaatcgag
acaagaggccggggatcgagactaaacatcattattgtggctgaaggagccatcaccaag
cagggccaacccatcacctcggagaacatcaaaaacttggttgttaaacgccttggctat
gacacgagagtcaccatcctcgggcacgtgcagcgtggtgggaccccctctgcctttgac
cgcatcctgggaagccgaatgggggtggaagcagtcatggccttgttggaagggaccccg
gataccccagcatgtgtcgtcagcctgtccgggaaccaagctgtccgcttgcctctcatg
gagtgtgtccaagtgaccaaagatgtcacaacagcaatgaatgagggacgatttgacgat
gctgttaaattgagaggaaggagcttccagaataactggaacgtttacaagttgctggct
cacgtgcgcccaccctctacaaagagcgggtataacctggccgtgatgaacgtcggcgct
ccagcctccgggatgaacgcagccgtgagggcggccgtcaggattgggctgatccatggg
cacaagatgctggctgtgcacgatgggtttgatggtctcgcccatggacaggtggaagag
attggctggggaggcgtaggtggctggactgggcttggtggatcgaaacttggcacaaaa
aggactctgcctaagaaatacttggaggaaatcagcgccaccatcagcagttttaacatt
caggggctgatcgtcatcgggggctttgaggctttcactgggagcttagagctcgtggaa
ggtcgtggcaaatacgaagagctctgtatcccggtgtgtgttattccagccaccgtgtcc
aacaacgtccccggctcggacttcagcatcggagcagacaccgccctcaatactatcacc
acgacctgtgaccgtatcaaacaatcttcagctggcaccaagaggcgggtgttcatcatc
gagaccatgggagggtactgcggctacctggccaccatggcaggcctggcttcaggagcg
gacgcggcttatatttttgaagatcccttcaccatccgcgacttacaggttaacgtcgag
catctgtgtgagaaaatgaagaccacagtgaagagaggcctggtgttgaggaatgagaag
tgcaatgaaaactacaccaccgacttcatcttcaacctgtattcggaggaagggaaaggc
atcttcgagagcaggaagaacgtcctgggacacatgcagcagggtgggacgccgactccc
ttcgacaggaactttggaactaagatgggtgcgaagtctgtggcatggctcaccggaaaa
atcaaggaatactccaggcatggtcgtatctttgccaacaccgcggattcagcctgcctc
ctgggcatgcgcagacggagtctcgtcttccagccactcgccgaactcgaagaacagaca
gattttgagcaccgcctccccaaacaacagtggtggctaaaacttcgtccaatcttaaag
attctggccaaatacaaggccgacttggatacctccgagaaagcccacctggaacacatc
acgcacaaggtggtgcctgtggaagccaacatctga

DBGET integrated database retrieval system