KEGG   Chrysemys picta (western painted turtle): 101950073Help
Entry
101950073         CDS       T04662                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101950073 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cpic04052]
    101950073 (THPO)
Cytokines and growth factors [BR:cpic04052]
 Cytokines
  CSF and other factors
   101950073 (THPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 101950073
NCBI-ProteinID: XP_005286072
LinkDB All DBs
Position
Un
AA seq 204 aa AA seqDB search
MELNRLLLLTAFLLHIKLSRMSPARLVCDNRLIQKYISEAKDMEKRVSQCQELPSLTQPL
PLPMVDFSLREWKTKTNETKRQEILCDLALLVDAVSAAQGHVRQECAAALLGQLYKKANS
FLLLLQTFSWQVSAWQPDRASRTTLQSHPSVIFLVYRQLVQGKLRFLFHDLAKDFCREGS
RGVPEPPSTPCPRLPQGDSESPAC
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggagttgaacaggctgctgctcctcacagcgttcctcctccacatcaagctgtccagg
atgagcccggcccggctggtctgcgacaaccggctgatccagaaatacatcagcgaagcc
aaggacatggagaagagagtgagccagtgccaggagctcccctcactaacgcagcccctt
cctctgcccatggtggacttcagcctccgggaatggaaaacgaagacaaatgagacgaaa
aggcaggaaatcctctgtgacctggcgctgctggtggacgcggtgagcgctgcgcagggc
cacgtgaggcaggagtgtgcggctgccctcctggggcagctctacaagaaagccaactcc
ttcctcctgctcctgcagaccttcagctggcaggtcagcgcctggcagccggaccgcgct
tcccggacaacgctgcagagccaccccagtgtgatatttctggtctaccggcagctcgtg
caaggcaaactgcgcttcctgttccatgacctggcaaaggatttctgccgggaaggaagc
cggggggtgccagagcccccaagcaccccatgtccccgcctgcctcaaggggacagtgaa
agccctgcctgctga

DBGET integrated database retrieval system