KEGG   Chrysemys picta (western painted turtle): 101951112
Entry
101951112         CDS       T04662                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04080  Neuroactive ligand-receptor interaction
cpic04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101951112 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101951112 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cpic04030]
    101951112 (LPAR2)
G protein-coupled receptors [BR:cpic04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    101951112 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 101951112
NCBI-ProteinID: XP_005311439
LinkDB
Position
Un
AA seq 344 aa
MRHCYYNESVGFFYNNSRKELTSYWRTKDVLVVVLGLTVSVIVLLTNLLVISAIIINRRF
HYPIYYLLGNLAAADLFAGIAYMFLMFHTGPRTAGLSLQTWFIRQSLLDTSLTASVVNLL
AIAVERHQTIFTMQLHSSMSNQRVVILIICIWVTALLLGLIPSYGWHCLCDLGNCSRMAP
LYSRSYLTFWALSNLVIFLIMVVVYTHIFVYVKRKMTSMSKHTSFHPRYKETMINLIKTV
IIILSAFVICWTPGQVLLLLDGLACESCNVLAMEKYVLLLAEINSLINAIVYSYRDNEMR
STFRKILCFICYRNPKYSPASVKSNVTKRRILSQNGHSIMDSSL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaggcactgctactacaacgagagtgtggggtttttctacaacaacagccggaaggag
ctgacctcctactggaggaccaaggatgttttggttgttgtcctgggcctgacagtcagc
gtcatcgtgctcctgaccaacctgctggtcatcagcgccatcattatcaaccggcgcttc
cactaccccatctactacctgctggggaacctggcggcagcggacctcttcgcgggcatt
gcctacatgttcctcatgttccacacggggcccaggacagcagggctctctctccagacc
tggttcatccggcagagcctcctggacaccagcctgactgcctcggtggtgaacctgctg
gccatcgcagtggagaggcaccagactatcttcaccatgcagctgcacagctccatgtcc
aaccagcgggtggtgatcctgatcatctgcatttgggtcacagccctgctgctgggcctc
atcccgtcctatggctggcactgcctgtgtgacctgggcaactgctccaggatggcgccc
ctctacagcaggagctacttgaccttttgggccctctccaacctggtcatcttcctgatc
atggtggtcgtctacactcacatctttgtctatgtcaagaggaagatgacgagcatgtcc
aagcacactagcttccacccccgctacaaggagaccatgatcaatctcatcaaaaccgtc
atcatcattctcagcgccttcgttatctgctggactccagggcaggtgctgctcctgctg
gacggcctggcctgtgagagctgcaatgtgctggcgatggagaagtatgtcctcttgctg
gcagagatcaattcgctcatcaacgccattgtctactcctatcgggacaatgagatgcgc
agcaccttccggaagatcctctgctttatctgctacaggaatcccaaatactctcctgcc
tcggtcaagtccaatgtcacgaaacgcaggattctctcgcagaacggccattctatcatg
gactcctcgctgtag

DBGET integrated database retrieval system